Pay in installments of $42.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 11 - Aug 16
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
IL-31 Protein, CanineProduct Specification Species Canine Synonyms IL 31,IL31,Interleukin 31 Accession C7G0W1 Amino Acid Sequence Ser24 Gln159 with C terminal 8*His MSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQHHHHHHHH Expression System E. coli Molecular Weight 17kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation Unconjugated Tag His Tag Physical Appearance
Product Specification
| Species | Canine |
| Synonyms | IL-31,IL31,Interleukin-31 |
| Accession | C7G0W1 |
| Amino Acid Sequence |
Ser24-Gln159 with C terminal 8*His MSHMAPTHQLPPSDVRKIILELQPLSRGLLEDYQKKETGVPESNRTLLLCLTSDSQPPRLNSSAILPYFRAIRPLSDKNIIDKIIEQLDKLKFQHEPETEISVPADTFECKSFILTILQQFSACLESVFKSLNSGPQHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | 17kDa (Reducing) |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4, 5% Trehalose. |
| Reconstitution | econstitute at 0.1-0.5mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference | 1. J Allergy Clin Immunol. 2023 Jul 13;S0091-6749(23)00888-6. Online ahead of print. |
Background
IL-31 which produced by activated Th2-type T cells. IL-31 signals through a receptor composed of IL-31 receptor A and oncostatin M receptor. IL-31 activates STAT3 and possibly STAT1 and STAT5 through the IL31 heterodimeric receptor composed of IL31RA and OSMR. IL-31 has also been identified as a major player in a number of chronic inflammatory diseases, including atopic dermatitis. Patients with atopic dermatitis, chronic spontaneous urticaria, allergic contact dermatitis, prurigo nodularis, primary cutaneous lymphoma and mastocytosis exhibit increased serum levels of IL-31 protein and elevated IL-31 mRNA in the skin.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy