SKU: 19890979744

LOX-1/OLR1 His Tag Protein, Mouse

Sale price$271.80 Regular price$302.00
Save 10%

Pay in installments of $75.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LOX-1/OLR1 His Tag Protein, MouseProduct Specification Species Mouse Synonyms CLEC8A, CLEC8ASLOX1, LOXIN, OLR1, SR E1 Accession Q9EQ09 Amino Acid Sequence Arg60 Ile363, with N terminal 9*His

Product Specification


Species Mouse
Synonyms CLEC8A, CLEC8ASLOX1, LOXIN, OLR1, SR-E1
Accession Q9EQ09
Amino Acid Sequence

Arg60-Ile363, with N-terminal 9*His HHHHHHHHHRQVSDLLKQYQANLTQQDRILEGQMLAQQKAENTSQESKKELKGKIDTLTQKLNEKSKEQEELLQKNQNLQEALQRAANSSEESQRELKGKIDTITRKLDEKSKEQEELLQMIQNLQEALQRAANSSEESQRELKGKIDTLTLKLNEKSKEQEELLQKNQNLQEALQRAANFSGPCPQDWLWHKENCYLFHGPFSWEKNRQTCQSLGGQLLQINGADDLTFILQAISHTTSPFWIGLHRKKPGQPWLWENGTPLNFQFFKTRGVSLQLYSSGNCAYLQDGAVFAENCILIAFSICQKKTNHLQI

Expression System HEK293
Molecular Weight 45-60kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Sawamura, T. et al. (1997) Nature 386:73. 

2.Daugherty, A. et al. (2000) Curr. Opin. Cardiovasc. Pulm. Ren. Invest. Drugs. 2:223. 

3.Platt, N. and S. Gordon (2001) J. Clin. Invest. 108:649. 3

4.Platt, N. and S. Gordon (1998) Chem. Biol. 5:R193.

Background

Lectin-like oxidized low-density-lipoprotein receptor-1 (LOX-1), also known as oxidized low-density-lipoprotein receptor-1 (OLR-1), is a type II transmembrane receptor belonging to the C-type lectin family. It also belongs to the functionally defined scavenger receptor (SR) superfamily, whose members share the common ability to bind and internalize modified forms of Low Density Lipoproteins (LDL). LOX-1 is the first member of the class E scavenger receptor subfamily (SR-E). It binds and supports the internalization of multiple structurally unrelated macromolecules including oxidized LDL, advanced glycation end products (AGE), activated platelets, bacteria, apoptotic or aged cells, and heat shock proteins. LOX-1 has also been implicated as an intestinal receptor involved in the transcytosis of pancreatic bile salt-dependent lipase. The human LOX-1 gene encodes a 273 amino acid (aa) residue protein with a short N-terminal intracellular domain, a transmembrane domain, an extracellular stalk/neck region followed by a C-type lectin-like domain (CTLD). The CTLD, which is required for ligand recognition, contains the six conserved cysteine residues present in all C-type lectins, but lacks the Ca2+-binding residues found in classical C-type lectins. LOX-1 can be detected on activated endothelial cells, vascular smooth muscle cells, macrophages, intestinal cells and dendritic cells. The expression of LOX-1 is induced by proinflammatory or proatherogenic stimuli, as well as by oxidized LDL itself and hemodynamic or oxidative stress. Human LOX-1 exists on the cell surface as covalent homodimers, which can further associate into non-covalent-linked oligomers. Cell surface LOX-1 can also be cleaved by yet unidentified proteases to release the soluble LOX-1 extracellular domain. Binding and endocytosis of oxidized LDL by LOX-1 induces oxidative stress, activates NF kappa B, and upregulates the expression of monocyte chemoattractant protein-1 and matrix metalloproteases. LOX-1-dependent oxidized LDL uptake also induces apoptosis by inducing the expression of the pro-apoptotic Bax and downregulation of the anti-apoptotic Bcl-2. Oxidized LDL plays a key role in the pathogenesis of atherosclerosis and endothelial dysfunction. Blockade of LOX-1 functions may turn out to be a suitable target for the therapeutic intervention of atherosclerosis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 19890979744

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
RTD2
Chelsea, US
★★★★★ 5
Impressive Sound Deadening Solution with Enhanced Audio Quality
Model: NewSLS50_52
I recently purchased the Siless 50 mil (1.3mm) 52 sqft Car Sound Deadening mat, and I am delighted with the results it has delivered. Right from the start, I was impressed with the packaging, which ensured the product arrived in perfect condition. One of the standout features of this sound deadening mat is its ease of use. It was a breeze to cut and modify according to my specific needs. Whether I needed to cover specific areas or customize the size, the mat accommodated my requirements effortlessly. This flexibility made the installation process a breeze. The Siless Sound Deadening mat has proven to be highly effective in reducing outside noise within my vehicle. With just a half cabin install, I noticed a significant reduction of approximately 10 decibels, making my driving experience much quieter and more comfortable. The mat acted as a reliable barrier against external noise, allowing me to enjoy a more peaceful ride. Furthermore, the sound quality from my vehicle's audio system experienced a noticeable improvement. The Siless mat effectively dampened vibrations and minimized resonance, resulting in cleaner and more refined audio output. The mat's thickness of 50 mil (1.3mm) ensures optimal sound absorption, contributing to its effectiveness in creating a quieter and more enjoyable driving environment. I can now appreciate the full range of tones and enjoy a more immersive music experience during my drives. Overall, I highly recommend the Siless 50 mil Car Sound Deadening mat for anyone seeking a reliable and effective solution to reduce noise and enhance audio quality in their vehicle. The easy cutting and modifying process, along with the excellent packaging, contribute to a seamless installation experience. With a significant reduction in outside noise and an improvement in sound system performance, this sound deadening mat has exceeded my expectations.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2023
C
Verified Purchase
Charles H.
Houston, US
★★★★★ 5
Good quality sound deadener at a good price.
Model: NewSLS50_52
Quality sound deadening that adheres to body panels well. You can easily hear the vibration reduction after just the first piece by tapping on the body panel before and after.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 21, 2025
N
Verified Purchase
Nick Frazier
Grantham, US
★★★★★ 4
Good stuff at a good price
Model: NewSLS50_52
Works well and sticks well. I used a roller and it has been over a year and everything still sticking as good as day i put it everywhere. I didnt use any adhesive but I did wipe everything down with acetone before I applied. Good stuff at a good price
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 23, 2025
D
Verified Purchase
Darren Gray
New York, US
★★★★★ 5
Good value
Model: NewSLS50_52, Model: NewSLS50_52
Working perfectly. Install of stereo equipment and carpet left me wanting some heat and sound resistant materials.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026
T
Verified Purchase
Tharin
Chelsea, US
★★★★★ 5
BUY THIS ONE!
Model: NewSLS50_52
This is one of the good ones. There are other brands just as good, and manny brands are worse, but this handles well, rolls down easily, doesn't come off at all easily, and adapts to dips and curves like a champ. Appropriately heavy and dead, I'm happy with the way it smothers panel resonances and even at muffling direct sound, like a big hand over my Uncle Harry's eternally noisy mouth. You can rip the foil but you have to work hard at doing that. Remember to buy a brayer; you can roll overlaps nice and thin. Also remember to pre-wipe the sheet metal with a decent solvent like acetone or Stoddard/Varsol. It should last forever.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2025

recommand products