SKU: 20901013839

SARS-CoV-2 (BA.4&BA.5/Omicron) RBD, His Tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

SARS-CoV-2 (BA.4&BA.5/Omicron) RBD, His TagProduct Specification Species SARS CoV 2 Accession P0DTC2 Amino Acid Sequence RVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight 35 kDa Purity >95% Endotoxin <0. 1EU g Conjugation Unconjugated Physical Appearance Lyophilized

Product Specification


Species SARS-CoV-2
Accession P0DTC2
Amino Acid Sequence

RVQPTESIVRFPNITNLCPFDEVFNATRFASVYAWNRKRISNCVADYSVLYNFAPFFAFKCYGVSPTKLNDLCFTNVYADSFVIRGNEVSQIAPGQTGNIADYNYKLPDDFTGCVIAWNSNKLDSKVGGNYNYRYRLFRKSNLKPFERDISTEIYQAGNKPCNGVAGVNCYFPLQSYGFRPTYGVGHQPYRVVVLSFELLHAPATVCGPKKSTNLVKNKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight 35 kDa
Purity >95%
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute at less than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

Samples are stable for up to twelve months from date of receipt at -20℃ to -80℃ Store it under sterile conditions at -20℃ to -80℃. It is recommended that the protein be aliquoted for optimal storage. Avoid repeated freeze-thaw cycles.

Background

Sars-cov-2 (2019-NCOV) infects human respiratory epithelial cells through binding to human ACE2 receptors. Spike protein is a large type I transmembrane protein containing two subunits S1 and S2.S1 mainly contains a receptor binding domain (RBD), which is responsible for recognizing cell surface receptors. S2 contains the basic elements required for membrane fusion. S protein plays a key role in inducing neutralizing antibody and T cell responses as well as protective immunity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 20901013839

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 23 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Michelle
Waukegan, US
★★★★★ 5
Storage
Color: Espresso, Size: 9.3 x 19.5 x 41.7 in
Helped with storage with games and movies
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 24, 2026
K
Verified Purchase
Katelyn
Whiting, US
★★★★★ 3
Okay small bookshelf
Color: White, Size: 9.3 D x 19.5 W x 41.8 H in
Glad I got this on a sale for our nursery. I don’t expect it to be that durable but it will be great for kid books and toys. Instructions are pictures only and a little overwhelming with all the lines, basically alternate shelves on either side from the middle and you’ll be fine and make sure your painted edges all face the same way. Quality isn’t the best as it split when screwing in and it wasn’t even in all the way, we were being careful but we flipped that part out of sight. The back is a flimsy board you nail in, wish it was another piece of particle board like the shelves to add stability. At least it has an anti tip strap but I’d get a better quality anti tip strap anyways. Upon assembly we were missing screws. Didn’t think we would need to count so many to make sure but I didn’t want to repack and return, luckily we have extra screws around the house. Pros: good for kids room, came with anti tip strap, came with screw stickers to cover, simple build Cons: could be better quality for (full) price, back flimsy board, missing screws, instructions could be better, not enough screw stickers to cover even just the outside… Overall an okay small bookshelf.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 27, 2023
N
Verified Purchase
Nora T
Phoenix, US
★★★★★ 4
Looks promising… but I haven’t built it yet 🛠📚
Color: White, Size: 9.3 D x 19.5 W x 41.8 H in
I haven’t actually assembled this 7-cube Amazon Basics bookcase yet, so I can’t comment on durability or stability. That said, everything arrived in good condition, the materials look solid, and the pre-drilled holes and pieces seem well-made. From first impressions alone, it seems like a quality piece that would fit nicely in a home or office space. I’m leaving a tentative rating based on appearance and packaging, but I’ll update if assembly goes smoothly or if I discover any issues. Pros: Materials look sturdy and well-made Pre-drilled holes and pieces seem accurate Sleek, simple design fits most rooms Good size for home or office storage Cons: Haven’t assembled it yet, so can’t comment on actual stability Star rating might change once it’s built and in use Verdict: Promising. Appears to be a quality cube organizer — I’ll update once I assemble it to confirm if it lives up to the look.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 28, 2025
Z
Verified Purchase
zeel
Bozeman, US
★★★★★ 5
Anyone with multiple monitors should buy this
I have been wanting something like this for years. I use three monitors, and keeping them all aligned is impossible. I've considered using tape, but that seems like it would lead to a sticky mess and it would never hold well. I imagined some solution with magnets, but never came up with anything that I thought I could implement myself. As soon as I saw this product, I was ordered two sets. I knew that this was either going to be a revolution, or a huge disappointment. It was not a disappointment. Installation is simple as can be, clean off your monitor back with some alcohol wipes (they should consider including some, would be a nice touch). For my screens, alignment was super easy because they have really square corners so I just stuck my aligners right at the corners and it worked great. For a screen with a curved back or something more geometric you probably want to get the screens in place first, then stick both parts at the same time. Either way, they stuck really well and the pads are flexible so they would work on a curved back just as well as flat. The brackets also have a locking part that allows you to slide them side to side a bit giving you more flexibility in mounting, and then you can lock them down once everything is lined up so they hold nice and firm. I also managed to screw up and put the wrong part on the wrong side, but luckily if you unlock the bracket you can slide the main part off of the adhesive part completely, so I was able to simply swap the two main parts without needing to peel the adhesive part off. It's a well thought out design and I was impressed by just how much flexibility there was in the mounting solution while still allowing for a very easy installation and rigid final setup. The magnets are strong, strong enough that if I needed to move a monitor regularly it would actually be annoying because while you can definitely take these apart they hold way too well to be doing so all the time. These are clearly intended for a permanent installation, without making it overly difficult to take things apart if you have to. If you have to turn a screen often though, such as to show something to a client or make the screen visible from another area of the room, I'm not sure if these will be what you need as they don't just come apart easily. If you want your screens to stay where you put them though, they are awesome! For me, these were perfect, and based on the design I think they should work well for most monitors and most setups. I'm so glad this product exists, it was well worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 10, 2025
J
Verified Purchase
Jimmy Mitchelll
Draper, US
★★★★★ 5
Great product!!!
I feel the price is a little high, but the product is amazing! Works just as described!!! I will be purchasing another set for the bottom of my work monitors. Currently their is just 1 set keeping these level.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026

recommand products