SKU: 22835555651

Human BCMA/TNFRSF17 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human BCMA/TNFRSF17 Protein, His TagProduct Specification Species Human Synonyms Tumor necrosis factor receptor superfamily member 17, B cell maturation protein, CD269, BCM, BCMA Accession Q02223 1 Amino Acid Sequence Protein sequence (Q02223 1, Met1 Ala54, with C His Tag) MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA Expression System HEK293 Molecular Weight Predicted MW: 5. 9 kDa Observed MW: 10, 13 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Physical

Product Specification


Species Human
Synonyms Tumor necrosis factor receptor superfamily member 17, B-cell maturation protein, CD269, BCM, BCMA
Accession Q02223-1
Amino Acid Sequence

Protein sequence (Q02223-1, Met1-Ala54, with C-His Tag) MLQMAGQCSQNEYFDSLLHACIPCQLRCSSNTPPLTCQRYCNASVTNSVKGTNA

Expression System HEK293
Molecular Weight Predicted MW: 5.9 kDa Observed MW: 10, 13 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 22835555651

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Benji Gulf Coast
Lake Worth, US
★★★★★ 5
A true beauty
Color: Red, Size: Large
This tuxedo set is so beautiful. The red is extremely striking and is sure to grab everyone's attention. I ordered a size L, as I am on the cusp of Medium and Large. The pants fit very well, and they have some adjustment points around the waist in case they need to be let out a little more. Also, in the waist band is some elastic portions, which make finding the perfect fit something you won't have to think much about.--- they will stretch with you. The jacket feels like it is custom fitted by a tailor. The quality of this tuxedo, considering the price point, is exceptional.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 6, 2025
M
Michael Woods
Natrona Heights, US
★★★★★ 5
Its great
Color: White, Size: Large
Got it for my brother and he digs it. Says its comfortable and not too confining. It looks great. Definitely worth the money.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 20, 2025
D
Verified Purchase
Dany
Los Angeles, US
★★★★★ 5
Tuxedo pants
Color: Black-velvet, Size: Medium
Pairs perfectly with my son's Prom jacket. Perfect fit and great quality. Size XL
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 6, 2026
K
Verified Purchase
K Bram
New York, US
★★★★★ 1
Size does not fit
Color: Black-satin, Size: Large
The pants fits like a 34......it could not be n buttoned and the crutch was extremely short n tight.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
I
Verified Purchase
Isaac U
Chelsea, US
★★★★★ 3
Size up at least once or twice if you buy these
Color: Black-satin, Size: Medium
I really wanted these pants to work because they actually look very nice and the material feels decent for a tuxedo pant. However, the sizing is completely off. I normally know my size pretty well, but these arrived and were way too small. I ended up reordering two different pairs in larger sizes trying to find the right fit, and even then, I couldn't get it quite right. Since I was in a major time crunch for an event, I eventually had to give up because I didn't have the time to go back for a third pair. It is a shame because the flat front style is exactly what I was looking for and the functionality of the clasp and zipper seemed solid. The value for money would be great if the fit was consistent, but the headache of returning and reordering makes it tough to recommend unless you have plenty of time to experiment with the sizes. If you decide to grab these, definitely plan on ordering at least one or even two sizes larger than what you usually wear. They have a nice professional look to them, but the durability of the fabric doesn't matter much if you can't actually get them on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2026

recommand products