SKU: 29645325599

Human CDKN2A/p16INK4a, His tag

Sale price$67.50 Regular price$75.00
Save 10%

Pay in installments of $18.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CDKN2A/p16INK4a, His tagProduct Specification Species Human Synonyms Cyclin dependent kinase 4 inhibitor A (CDK4I), Multiple tumor suppressor 1 (MTS 1), p16 INK4a (p16 INK4; p16INK4A), CDKN2, MTS1 Accession P42771 Amino Acid Sequence Protein sequence (P42771, Met1 Asp156, with C 10*His) MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPDGGGGSHHHHHHHHHH Expression System

Product Specification


Species Human
Synonyms Cyclin-dependent kinase 4 inhibitor A (CDK4I), Multiple tumor suppressor 1 (MTS-1), p16-INK4a (p16-INK4; p16INK4A), CDKN2, MTS1
Accession P42771
Amino Acid Sequence

Protein sequence (P42771, Met1-Asp156, with C-10*His) MEPAAGSSMEPSADWLATAAARGRVEEVRALLEAGALPNAPNSYGRRPIQVMMMGSARVAELLLLHGAEPNCADPATLTRPVHDAAREGFLDTLVVLHRAGARLDVRDAWGRLPVDLAEELGHRDVARYLRAAAGGTRGSNHARIDAAEGPSDIPDGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight Predicted MW: 18.2 kDa Observed MW: 18.2 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CDKN2A, also known as cyclin-dependent kinase inhibitor 2A, is ubiquitously expressed in many tissues and cell types. The gene codes for two proteins, including the INK4 family member p16 (or p16INK4a) and p14arf. Both act as tumor suppressors by regulating the cell cycle. p16 inhibits cyclin dependent kinases 4 and 6 (CDK4 and CDK6) and thereby activates the retinoblastoma (Rb) family of proteins, which block traversal from G1 to S-phase. Somatic mutations of CDKN2A are common in the majority of human cancers, with estimates that CDKN2A is the second most commonly inactivated gene in cancer after p53. Germline mutations of CDKN2A are associated with familial melanoma, glioblastoma and pancreatic cancer. The CDKN2A gene also contains one of 27 SNPs associated with increased risk of coronary artery disease.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 29645325599

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 15 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
Jessica
Boise, US
★★★★★ 5
Delicious!
Flavor Name: Original, Lemon Garlic, Hot & Spicy, Size: 4 Ounce (Pack of 3)
Absolutely frickin delicious! The size is good for what you get. I use a bag 3 times for salads. Very easy to keep in the fridge and open and close. I think compared to jars and other olives and the quality it is a good price. The flavor is awesome!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 12, 2025
A
Verified Purchase
Astra
Boise, US
★★★★★ 5
Bruh..
Flavor Name: Chicken Sriracha, Size: 1 Count (Pack of 1)
Bruh, these go hard..
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
R
Verified Purchase
Rachel
Massapequa, US
★★★★★ 5
Yum spicy
Flavor Name: Chicken Sriracha, Size: 1 Count (Pack of 1)
All time favorite flavor of these meat sticks. The spicy chicken is the best. Will keep buying
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 12, 2026
H
Verified Purchase
Hungry
Carnegie, US
★★★★★ 3
Not comparable to the bars
Flavor Name: Chicken Sriracha, Size: 1 Count (Pack of 1)
I often get the chicken Sriracha bars, so I thought this is a more economical way to get that bit of protein. However, these are extremely different than the bars. They are thinner, obviously, and that makes the whole bar drier and... I'm not sure how to describe it, it almost tastes like plastic. Overall, I'll get the bars any day, but these I really can't stomach. On the spiciness side, I think they're pretty balanced. My husband, who doesn't tolerate heat well, likes them, so I'd say they're mild spice. But I personally cannot get over the plastic flavor.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 7, 2025
E
Verified Purchase
EOTE83
Phoenix, US
★★★★★ 1
For the chicken go with the bars, not the strips.
Flavor Name: Chicken Sriracha, Size: 1 Count (Pack of 1)
I really enjoyed the larger Sriracha bars, as they were an excellent combo of spicy, salty, and juicy. Bought these strips under the assumption they'd be the same. Not even close. No detectable salt, only the barest hint of spice (you can sort-of get the spice back if you eat a large chunk and chew it for around a minute), and the flavor when you first stick it in your mouth is dry and interrupted by a weird plastic-like taste for the first ten seconds or so. Since it's food I can't return them. At $40 it's an expensive lesson learned. Go with the bars, not the strips.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 9, 2025

recommand products