SKU: 31107230743

TNF-α Protein, Human

Sale price$82.80 Regular price$92.00
Save 10%

Pay in installments of $23.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

TNF-α Protein, HumanProduct Specification Species Human Synonyms TNF , Cachectin, Tumor Necrosis Factor Alpha, TNFSF1A Accession P01375 Amino Acid Sequence Val77 Leu233, with N terminal 8*His MHHHHHHHHVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL Expression System E. coli Molecular Weight 18. 5kDa Purity >95% by SDS PAGE Endotoxin <1EU g Conjugation

Product Specification


Species Human
Synonyms TNF-α, Cachectin, Tumor Necrosis Factor-Alpha, TNFSF1A
Accession P01375
Amino Acid Sequence

Val77-Leu233, with N-terminal 8*His MHHHHHHHHVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL

Expression System E.coli
Molecular Weight

18.5kDa

Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

20mM Tris, 150mM NaCl, 2mM TCEP, pH8.5

Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Reference

1、Hector J. et al. (2007) TNF-alpha alters visfatin and adiponectin levels in human fat. Horm Metab Res. 39(4): 250-255.

2、Berthold-Losleben M. et al. (2008) The TNF-alpha System: Functional Aspects in Depression, Narcolepsy and Psychopharmacology. Curr Neuropharmacol. 6(3): 193-202.

Background

Tumor necrosis factor α (TNF alpha) is an effective pro-inflammatory cytokine, which can kill and inhibit tumor cells. It is mainly produced by activated macrophages and can also be secreted by other types of cells, such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils and neuronal tissues. The members of TNF alpha family exert their cellular effect through two distinct surface receptors of the TNF receptor family, TNFR1 and TNFR2. The pleiotropic biological effects of TNF can be attributed to its ability to simultaneously activate multiple signaling pathways in cells. TNF-induced NF-κB activation promotes the growth, invasion and metastasis of cancer cells.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 31107230743

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 13 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
LouLou
Chelsea, US
★★★★★ 1
Not worth the money
The dog toy that I received looks nothing like the picture. There is no stuffing, the seams are on the outside leaving frayed fabric exposed and toy itself is tiny. It is being returned.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2024
B
Verified Purchase
Beth N
Battle Creek, US
★★★★★ 5
Owls love it too!
My friend who is a licensed Master Falconer currently has an Owl as her partner. The owl (a female) is playful and had stolen a dog toy a while back and played with it until she shredded it. She loves her squeaky fish and plays with it every morning, tossing it about or shaking it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 14, 2025
B
Verified Purchase
Becky
Alexandria, US
★★★★★ 5
Great toy
Style: Crappie
Bought this for my "nephew" dog who goes fishing with us every year in a boat. Keeps him busy. He loves it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 28, 2025
B
Beck
Los Angeles, US
★★★★★ 4
Sturdy but stitched weird
This is a sturdy toy with thick fabric. I love the printing and the rope inside. My coonhound destroys anything resembling plush in a heartbeat and this is perfect for her. The weird thing is the stitching. When making something with a pattern, you'd usually turn the outsides to each other, stitch it up, then turn it "inside out" (which is then actually right-side out) and stitch up the last bit after filling or whatever. This was just put together right-side out and stitched, so it looks kind of unfinished. The stitching is solid, no complaints there, but it keeps it from being a great gift, which it could be if it was stitched better. When I looked at the pictures of the different options I noticed some were stitched like mine and some "normally". Weird. Otherwise great.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 24, 2022
A
Verified Purchase
Allison V
Phoenix, US
★★★★★ 5
Crappie toy
Style: Crappie
Our Zoey loves this toy! When we couldn’t find her favorite toy anymore we ordered this one. She loves it!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 16, 2024

recommand products