SKU: 33882524337

Human papillomavirus type 16 E7

Sale price$99.00 Regular price$110.00
Save 10%

Pay in installments of $27.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human papillomavirus type 16 E7Product Specification Species Human papillomavirus type 16 Accession P03129 Amino Acid Sequence Protein sequence (P03129, Met1 Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP Expression System E. coli Molecular Weight Predicted MW: 11. 0 kDa Observed MW: 17 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a 0. 2 m filtered

Product Specification


Species Human papillomavirus type 16
Accession P03129
Amino Acid Sequence

Protein sequence (P03129, Met1-Pro98) MHGDTPTLHEYMLDLQPETTDLYCYEQLNDSSEEEDEIDGPAGQAEPDRAHYNIVTFCCKCDSTLRLCVQSTHVDIRTLEDLLMGTLGIVCPICSQKP

Expression System E.coli
Molecular Weight Predicted MW: 11.0 kDa Observed MW: 17 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Human papilloma viruses (HPVs) can be classified as either high-risk or low-risk according to their association with cancer. HPV16 and HPV18 are the most common of the high-risk group while HPV6 and HPV11 are among the low-risk types. Approximately 90% of cervical cancers contain HPV DNA of the high-risk types. Mutational analysis have shown that the E6 and E7 genes of the high-risk HPVs are necessary and sufficient for HPV transforming function. The specific interactions of the E6 and E7 proteins with p53 and pRB, respectively, correlate with HPV high and low risk classifications. The high-risk HPV E7 proteins bind to pRB with a higher affinity than do the low-risk HPV proteins. HPV E7 plays a major role in HPV-induced malignancy, perturbing cell cycle regulation, and driving cell proliferation. Major targets of cancer-causing HPV E7 proteins are the pRB family of tumor suppressors, which E7 targets for proteasome-mediated degradation and whose interaction is promoted through an acidic patch, downstream of the LXCXE motif in E7, that is subject to phosphorylation by casein kinase II (CKII).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 33882524337

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
J
Verified Purchase
jsaint
Massapequa, US
★★★★★ 5
Gorgeous & so soft!
Size: 50"x60", Color: Olive Green
This is hands down the most beautiful throw I’ve ever had. It’s so soft & luxurious on both sides, which is hard to find. It’s warm but not too warm ,just perfect! I got the olive green & it’s a beautiful shade, not too yellow or muddy. I don’t know why people report shedding issues, I wonder if there were some bad batches? Mine hasn’t shed at all. Just washed it for the first time, came out perfect. No lint at all in dryer screen.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 13, 2026
S
Verified Purchase
Sarah Pseudoscience
Pawtucket, US
★★★★★ 5
For a luxurious throw,
Size: 50"x60", Color: Grey
I originally bought this throw just to have something cozy around the house—and I was immediately impressed with how unbelievably soft it is. After owning (and loving) a lot of blankets, I’ve realized most only have that plush, silky feel on one side. This one is different—it’s soft on both sides, with a weight and drape that feels genuinely luxurious. The dark gray color is another standout. It looks elevated and expensive, and it’s held up beautifully through multiple washes without losing that silky texture at all. It honestly feels just as soft as the day we got it, which is rare. But the reason I had to write this review is unexpected. We’ve been sleep training our almost 1.5-year-old son, and this blanket somehow became part of the routine. It lives in his room, draped over the rocking chair for those long middle-of-the-night wakeups. Over time, he started pulling it down and choosing to sleep on top of it… on the floor. We couldn’t tell if he preferred the floor—or the blanket. So I tried something: I put the throw on his bed. And just like that… he started sleeping in his bed. Apparently, this blanket is the key to sleep training. If you’re looking for something soft, durable, and genuinely cozy, this is already a great buy. But if you happen to have a toddler resisting bedtime… this might just be your secret weapon too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 12, 2026
R
Verified Purchase
Rachel
Belleville, US
★★★★★ 5
Very soft. Wash only on gentle cycle in cold water and low tumble dry. Fabulous blanket.
Size: 50"x60", Color: Orange
So far so good. It was a little sheddy at first but then I washed it and it was fine. It is super soft even after being washed twice. Several people have commented on how soft it is and stated they thought it was a Minky couture. I washed it on gentle cycle in cold water and dried it on gentle low tumble dry. It does not seem to be shedding now. I washed it a second time and put vinegar in the rinse cycle because supposedly that is supposed to help bind the fibers or something. Still seems to be not shedding. It's probably the softest blanket I have every owned. When I wash it, I will continue to wash it on gentle in cold water and dry on either gentle low tumble dry r just air fluff. I read the heat good make the fibers loose and cause more shedding. If anything changes, I will update.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 2, 2026
S
Verified Purchase
Stacy Gaspard
Port Orchard, US
★★★★★ 5
All time favorite
Size: 50"x60", Color: Orange, Size: 50"x60", Color: Orange
It is the best blanket I have ever had. It doesn’t shed, it stretches, it is unbelievably soft and cozy, and my cats cannot snag it no matter how hard they try!! I love it. It is also the perfect Universoty of Texas burnt orange shade!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 12, 2026
M
Verified Purchase
Melissa Benitez
Belleville, US
★★★★★ 4
Quality of fabric may be less plush.
Size: 50"x60", Color: Tan
Very soft and plush blanket, although it not as thick and heavy as previously purchased in another color (same brand) it’s still a nice blanket.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026

recommand products