SKU: 35661447784

HBV Surface Antigen-preS2 Protein

Sale price$86.40 Regular price$96.00
Save 10%

Pay in installments of $24.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

HBV Surface Antigen-preS2 ProteinProduct Specification Species HBV Synonyms Middle surface antigen; PreS2 Accession P03140 Amino Acid Sequence MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN Expression System E. coli Molecular Weight 5. 8 kDa(Reducing) Purity 95%, by SDS PAGE under reducing conditions Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer 20mM PB, 50mM NaCl, pH7. 4 Reconstitution Reconstitute at less than 1

Product Specification


Species HBV
Synonyms Middle surface antigen; PreS2
Accession P03140
Amino Acid Sequence

MQWNSTTFHQALLDPRVRGLYFPAGGSSSGTVNPVPTTASPISSIFSRTGDPAPN

Expression System E.coli
Molecular Weight

5.8 kDa(Reducing)

Purity >95%, by SDS-PAGE under reducing conditions
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer

20mM PB, 50mM NaCl, pH7.4

Reconstitution

Reconstitute at less than 1 mg/mL according to the size in ultrapure water after rapid centrifugation .

Stability & Storage

· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.

· 3 months, -20 to -80℃ under sterile conditions after reconstitution.

· 1 week, 2 to 8℃ under sterile conditions after reconstitution.

· Please avoid repeated freeze-thaw cycles.

Background

Hepatitis B surface antigen S2 (HBV Surface Antigen-preS2) is the smallest unit of transcriptional activator encoded by the surface gene of hepatitis B virus (HBV). It can be used as an auxiliary diagnostic reagent for hepatitis B virus infection. It exists in more than 1/3 of HBV integration units, and HBV integration units are an important factor in inducing liver cancer (HCC). HBV Surface Antigen-preS2 is also an effective regulator of apoptosis induced by tumor necrosis factor-related apoptosis-inducing ligand (TRAIL). It is involved in promoting hepatocyte apoptosis induced by TRAIL, thereby increasing the risk of malignant transformation of human hepatocellular carcinoma cell line (HepG2).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 35661447784

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Allegra C.
New York, US
★★★★★ 5
Worth the hype on NPR that led me here--I've found my new favorite book!
Format: Hardcover
As an Asian-American creative, I knew I'd love this when I first read a positive review for this online, and I was not disappointed once! The perspective is so unique--a Chinese girl in 1800s Georgia!--and the writing's mesmerizing. I wished this book could never end, and LOVED it for so many reasons: The quick version: -Have you ever read anything about Chinese-Americans living in the Reconstructionist South? Thought not. This book provides such a necessary historical lens into highly underrepresented people and untold stories--and does it with remarkable talent and grace. This alone is worth heavy consideration. -Jo is a protagonist you can't help admiring - she's witty, a nonconformist by circumstance and by choice, and unafraid of getting back a little (or a lot) at people who've done her wrong. -The narrative voice is unlike any I've ever seen before ("Mischief dangles from his smile") and there are great humorous moments. -Great pun one-liners here and there - even Yours Truly, who admits to hating puns, likes how they're done here. -A wonderful and dynamic supporting cast, including Jo's wry adoptive father, a socialite who reveals her cleverness with pepper, an enigmatic Southern Belle who becomes Jo's employer for the second time, and a stout-of-heart black boy that'll melt your cold dead heart. Also a very enthusiastic herding dog. -A climax that honestly almost moved me to tears from the poignancy, but also the deep symbolism of how Jo's actions come to stand for so, so much more in those several pages. -If you like to learn cool new words, you'll definitely learn a few by reading this. -On a personal note, I was ecstatic to find references to Chinese knotting and barley tea, which I've grown up with, but never encountered in print before. Stacey Lee isn't afraid to show how difficult it was to be Asian-American in post-Civil War Georgia: In the opening scene, Jo is fired from her job at a hat shop because of her ethnicity. Due to the Chinese Exclusion Act in effect at the time, Jo and her adoptive father are legally not US citizens and cannot even own land or rent; they're forced to live secretly as squatters in the basement of a family who prints a struggling local newspaper. We also see realistic depictions of other social issues, like the initial implementation of segregation laws (which confuses Jo and her father, as they're neither black nor white), the erecting of Confederate statues, calls for women's suffrage (as well as the emergence of modern bicycles) treated with derision by many women who think the idea foolish, and white suffragists rejecting black women who support their ideals. In all seriousness, get this book. If you have kids, get this for your kids. I rarely write book reviews, but I'm breaking the pattern because this novel is THAT good. Come for the incredibly unique historical perspective that's surely the first of its kind ever published and shines a spotlight on sorely underwritten stories. Stay for Jo's incredible strength, role model-ism, one-of-a-kind journey, and how her story reminds us all not just of the power of devastatingly clever puns, but the power that words give all of us in finding who we are and making the world a better place.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 25, 2019
J
Verified Purchase
Jamie McQuiston
Cuba, US
★★★★★ 4
"Luck rides a horse named Joy"
Format: Kindle
What a delightful book! I was constantly rooting for the protagonist, Jo. She grew up without a true mother or father but found guidance and love with a Chinese man named Old Gin. They both found work with an aristocratic family as servants, while living secretly in the basement of a printing company. It was there that Jo learned to read and write through listening to the family who owned the printing press upstairs. She discovers the paper they publish, The Focus is in trouble and decides to help them out by secretly writing a column under the name Miss Sweetie. An adventure begins and secrets are revealed, but Jo emerges as a local hero as a result. I loved the author's prose and they way she incorporated Chinese anecdotes. I laughed out loud and cried in equal measure. It is a story about overcoming the struggle of race and poverty, but also about love and fighting for what you believe in. I highly recommend if your in the mood for something uplifting to read.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2021
N
Verified Purchase
Nicole @ Nicoles' Novel Reads
Omaha, US
★★★★★ 5
Excellent historical novel during the Gilded Age
Format: Hardcover
During the late 1800's Jo Kuan lives with her stand-in father, Old Gin, in a basement. She works as a milliner's assistant until she is let go one day because her employer deems that she is too opinionated and makes customers uncomfortable. However, there is one customer, Mrs. Bell, who admires Jo's craftmanship making intricate knots, which happens to be the lady who resides in the same residence as Jo. However, Mrs. Bell doesn't know Jo and Old Gin take refuge below the residence. Jo is given the opportunity to write as Miss Sweetie for the Focus's advice column when she sends an anonymous letter to the Bells. Miss Sweetie creates a huge buzz in her community. Jo anonymously writes articles regarding societal norms during the Gilded Age time period. What a great opportunity for someone who is "too opinionated." While she works as a lady's maid at the Paynes household during the day, she moonlights as Miss Sweetie at night. Stacey Lee tells a wonderful and insightful story of what it means to be Asian in the South of the United States in the late 1800's. I am always delighted to read historical fiction with characters I can relate to. I often wonder how life was for Chinese-Americans in the past. There is hardly any information about the history of Chinese-Americans living in the United States and how life was for them. Lee is one of my favorite historical fiction novelists. Her characters are relatable and I love being transported to a different time period and a different location every time I pick up one of her books. I absolutely love the voice of Jo. She is sassy but she knows her place. Jo is an advocate of women's rights and equality for all races. Being of Chinese descent, she teeters in between Whites and Blacks. It's hard to find a place in society, especially since there are not many Asian people living in the United States at the time. Most Chinese in the States at the time are men working on the railroad. Jo is longing to know more information regarding her parents. Who is her birth father? Who is her birth mother? Why was she given up? Jo is fortunate to have Old Gin raise her. The twist at the end caught me off guard for sure. Although Jo may feel out of place, she has Old Gin as her family. I also enjoyed reading how Jo finds solace in Sweet Potato and she finds friendship with Noemi. Jo even has a complex relationship with Caroline Payne, who can be very cruel. The Downstairs Girl shows readers a glimpse of the Gilded Age and what is it like to live as an Asian American during that time period. Jo defies the stereotype of Asian women being docile and quiet. Not only does she defy the stereotype for Asian women but she defies the gender stereotype of being a lady. Jo is quite capable of doing what a man does and she is quite outspoken. From writing in a newspaper to horse racing, Jo can do anything!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 11, 2019
G
Verified Purchase
G. R. Jack
Alexandria, US
★★★★★ 5
A story of someone who refuses to settle for less
Format: Hardcover
Stacey Lee takes you into a world you’re probably familiar with if you paid any attention in your U.S. History class and helps you see it in new ways. Most of us are familiar with the agonies of post reconstruction era South, but few stories shine a spotlight on the Chinese laborers who were shipped in by Southern plantation owners to replace emancipated slaves. This is the world seventeen-year-old Jo Kwan lives in. Much of Jo’s life is lived in secret. She can’t rent, let alone own, property, so she’s forced to live with her uncle in the basement of a white family who owns a failing newspaper. She can’t interact directly with the white patrons of the hat store because her boss says she makes the customers “uncomfortable.” She can’t even participate in the growing Suffrage movement because the women are only concerned with advancing the rights of white women. What’s a strong, opinionated girl to do? Start an advice column. She starts submitting columns to the paper under the pseudonym Miss Sweetie and immediately attracts attention, both good and bad, from Atlanta’s high society. Through the column, Jo finds her voice and an outlet to express views on her segregated and chauvinistic society. The more freedom she experiences, the more she wants and soon she is uncovering secrets of her past that threaten to ruin her. The Downstairs Girl never lets the reader forget how crushing life was for Chinese and Black Americans during this time, but the book isn’t a downer. Mostly this is due to Jo Kwan being such a spirited and sympathetic character. Her story is one of someone who refuses to settle for less and it’s fun watching her get the best of some of her antagonists. Lee’s writing is also witty and engaging, filled with the kind of southern colloquialisms that help transport the reader to this time and place.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 4, 2019
K
Verified Purchase
KKV
Phoenix, US
★★★★★ 4
A great vacation read
Format: Kindle
I was looking for something interesting but not a lengthy novel. Really enjoyed this book. It was a quick read while on vacation and is anchored in a historical perspective I had not ever considered, that of being both Chinese and a woman in the South (Atlanta) at the time of the Women’s suffrage movement. The character is subject to the same segregation laws and lack of rights as a Black woman at the time. This is a clever, strong, female character who surmounts several obstacles created by the environment in which she lives.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 27, 2021

recommand products