SKU: 36665284037

IL-7 Protein, Human

Sale price$106.20 Regular price$118.00
Save 10%

Pay in installments of $29.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL-7 Protein, HumanProduct Specification Species Human Synonyms Interleukin 7 Accession P13232 Amino Acid Sequence Asp26 His177 with C terminal 6*His Tag DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH Expression System HEK293 Molecular Weight 18 30 kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <1EU mg Conjugation Unconjugated Tag His Tag Physical Appearance

Product Specification


Species Human
Synonyms Interleukin-7
Accession P13232
Amino Acid Sequence

Asp26-His177 with C-terminal 6*His Tag

DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEFNFFKRHICDANKEGMFLFRAARKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGRKPAALGEAQPTKSLEENKSLKEQKKLNDLCFLKRLLQEIKTCWNKILMGTKEHHHHHHH

Expression System HEK293
Molecular Weight 18-30 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <1EU/mg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer 10 mM PBS, pH 7.4.
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Proc Natl Acad Sci U S A. 1989 Jan;86(1):302-6.
2. J Biol Chem. 1997 Dec 26;272(52):32995-3000.
3. J Immunol. 1995 Jan 1;154(1):58-67.

Background

Interleukin 7(IL-7)is a mature protein of 177 amino acids with a signal sequence of 25 amino acids and a calculated mass of 17.4kDa. Recombinant human IL-7 stimulated the proliferation of murine pre-B cells and was active on cells harvested from human bone marrow that are enriched for B-lineage progenitor cells.

IL-7 is a proteinaceous biological response modifier that has a bioactive tertiary structure dependent on disulfide bond formation.

IL-7-stimulated pro-B cells partially differentiated into a pre-B cell population, on the basis of the loss of CD34 and terminal deoxynucleotidyl (TdT) expression, and the acquisition of cytoplasmic mu heavy chains.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 36665284037

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
tjrking
New York, US
★★★★★ 5
Best Mineral Sunscreen
Style: Tropical Coconut
The only mineral sunscreen I’ve found that doesn’t leave a white residue. Smells amazing and pregnancy safe!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 27, 2025
E
Verified Purchase
E
Whiting, US
★★★★★ 4
This sunscreen body lotion is quite nice.
Style: Piña Colada
This sunscreen body lotion seems to work well. SPF 30 is the highest I could find with moisturizing capabilities. The smell is a bit overwhelming when you first put it on but it then goes away... so why the added scent. I wish it were SPF 50 and unscented. Otherwise I would have given it 5 stars.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 19, 2023
C
Verified Purchase
Christina Visser
Cuba, US
★★★★★ 5
My go to!
Style: Tropical Coconut
I freaking love this sunscreen, not only is the smell divine, but a little goes a long way. It doesn’t leave a greasy feeling or residue.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 15, 2025
C
Verified Purchase
C. Herman
Grantham, US
★★★★★ 5
Great stuff.
Style: Tropical Coconut
No weird smell or greasy residue, feels great on the skin. Tried it while on vacation (friend's lotion), and bought some when I got home. It is my go to now.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 1, 2025
M
Verified Purchase
Melissa Rios
Draper, US
★★★★★ 5
So refreshing, you’ll forget it’s sunscreen.
This stuff is fantastic. I love the super fine mist and how easily the pump works. It is soo refreshing and smells like fresh coconut. Ot doesn’t sting or burn my sensitive eyes, and it leaves my skin feeling revitalized and moisturized, not sticky or tacky. It feels amazing when it’s hot outside and you need a quick refresh and it won’t disturb my makeup. Coola is becoming one of my favorite sunscreen brands.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 31, 2025

recommand products