Pay in installments of $56.25 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 15 - Aug 20
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP8 His Tag Protein, HumanProduct Specification Species Human Synonyms Fatty acid binding protein 8, P2, PMP2 Accession P02689 Amino Acid Sequence Ser2 Val132, with N terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV Expression System E. coli Molecular Weight 18kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical
Product Specification
| Species | Human |
| Synonyms | Fatty acid binding protein 8, P2, PMP2 |
| Accession | P02689 |
| Amino Acid Sequence | Ser2-Val132, with N-terminal 8*His MHHHHHHHHSNKFLGTWKLVSSENFDDYMKALGVGLATRKLGNLAKPTVIISKKGDIITIRTESTFKNTEISFKLGQEFEETTADNRKTKSIVTLQRGSLNQVQRWDGKETTIKRKLVNGKMVAECKMKGVVCTRIYEKV |
| Expression System | E.coli |
| Molecular Weight | 18kDa (Reducing) |
| Purity | >95% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
FABP8 (fatty acid binding protein-8; also M [myelin]-FABP, P2 and PMP2) is also known as peripheral myelin protein 2, which is a cytosolic protein found primarily in peripheral nerves. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin. Also, PMP2 may play a role in lipid transport protein in Schwann cells. Furthermore, PMP2 may bind cholesterol. PMP2 is a small, basic, and cytoplasmic lipid binding protein of peripheral myelin, which is a cytosolic protein found primarily in peripheral nerves.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.8 ★★★★★
Based on 28 reviews
Sort
Product Reviews
★★★★★ 5
Worked like a charm
Style: Bundle, Size: 2 Piece Set
I’ve tried other acne patches before and they’ve always pulled excess oil out of my pores, which ended up drying, scarring, and leaving behind a dry patch when compared to the rest of my face. These effects were especially bad for my cystic acne, which always ended up more inflamed and painful after treatment.
The Rael hydrocolloid patches gently pulled out all of the sebum from several pimples that I’d avoided picking at; with other brands, the patches only pulled anything out from pimples that had already been picked at/burst. The micro needle patch also relieved my cystic acne overnight. The pimple is no longer inflamed or painful. When I took the patch off, I could see the liquid and oils that it had pulled out BUT didn’t experience the scarring I have with other patches. Other reviews mention that the patches are fragile, but I don’t necessarily think that’s any different from the other brands I’ve tried. I had no problem trying to get one out of the package on the first try.
Overall, I think these are a really good fit for folks with oily skin who experience scarring with other patches. These definitely pull more sebum and not as much oil, so you should see your pimples decrease in size without adding to the inflammation. The patches adhere well and stayed on all night without peeling off (even though I’d accidentally bunched up some edges on the hydrocolloid patches when applying). I’m definitely going to keep a stock of both types readily available!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 23, 2020
★★★★★ 5
Praise Rael.
Style: Bundle, Size: 2 Piece Set
I suffer from cystic acne (on my chin and jawline, so probably connected to hormones) as well as dematillomania, or skin picking disorder. It's so hard for me to not pop the big honkers, especially when these painful zits have been around for days/weeks. All I want is clear skin, but cystic acne combined with skin picking leaves me with scars that take months to fade even when I'm pimple-free .
I've been using Rael's Miracle Patch (pink package) for awhile. This is a great product, and works best on more surface-level zits. Last night, I tried the Acne Healing Patch (green package) on a persistent cystic zit I've already tried to extract, plus another cyst brewing on the other side of my chin. I've used so many different products to treat cystic acne, but nothing has worked like Rael's Acne Healing Patch. I kept the patches on overnight, and in the morning I found both had reduced significantly in size. The zits are well on their way to healing, and I finally feel like I will be able to treat cystic blemishes effectively and go concealer-free in the coming months.
I never write reviews, but I felt I should share this experience with Rael patches. Acne can be so mentally debilitating, and I've been helped by a lot of fellow acne sufferers who share their experiences in product reviews. I hope my review is helpful for someone else.
Thank you Rael, for a truly game-changing cystic acne treatment!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2020
★★★★★ 5
Picky dog approved!
Color: S6-muti-color, Color: S6-muti-color
I have wasted so much money on dog balls that they won't even pick up! They finally were obsessed with the Kong rubber green/blue or red/blue ones, but they're $3+. each, and they break from the dogs squishing it. I honestly had zero expectations on these, and they BOTH picked them up on the first throw! That's huge!!
Seem to work fine in the ChuckIt.
As for the squeaker, at first I was like "Oh nooooo." when they both loudly started! Much to my (and my neighbors') happiness, the squeakers stopped working after a couple minutes. 🤣
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 2, 2025
★★★★★ 5
Great dog toys
Color: S6-muti-color
These are long lasting, durable dog toys. My dogs love the squeak sound.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2026
★★★★★ 5
Durable
Color: S6-muti-color
The balls are great for chewers. The squeaky didn’t last long but they are perfect for the ball launcher.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 18, 2026
recommand products
Cisco C9300L-24UXG-4X-A 24x 1GB UPoE RJ45 (8x MultiGB) 4x 10GB SFP+ Switch
1322.99
NEW Brocade ICX6610-48-PE 48x 1GB RJ45 8x 1GB SFP F-B Airflow (Premium) Switch
985.00
Cisco N55-M16UP Nexus 5500 Series 16x 10GB SFP+ Switch Module
39.99
NEW Dell 470-ABMP 10m 40GB QSFP+ to 4x 10GB SFP+ D0HM1 Direct Attach Cable
127.99
Juniper PTX10K-LC1102 PTX 10000 Series 36x 40G QSFP+ Router Line Card
15223.00