SKU: 41691599076

Human CD1D Protein, His tag

Sale price$157.50 Regular price$175.00
Save 10%

Pay in installments of $43.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD1D Protein, His tagProduct Specification Species Human Synonyms Antigen presenting glycoprotein CD1d, R3G1, CD1d Accession P15813 Amino Acid Sequence Protein sequence (P15813, Val21 Gly296, with C His tag)

Product Specification


Species Human
Synonyms Antigen-presenting glycoprotein CD1d, R3G1, CD1d
Accession P15813
Amino Acid Sequence

Protein sequence (P15813, Val21-Gly296, with C-His tag) VPQRLFPLRCLQISSFANSSWTRTDGLAWLGELQTHSWSNDSDTVRSLKPWSQGTFSDQQWETLQHIFRVYRSSFTRDVKEFAKMLRLSYPLELQVSAGCEVHPGNASNNFFHVAFQGKDILSFQGTSWEPTQEAPLWVNLAIQVLNQDKWTRETVQWLLNGTCPQFVSGLLESGKSELKKQVKPKAWLSRGPSPGPGRLLLVCHVSGFYPKPVWVKWMRGEQEQQGTQPGDILPNADETWYLRATLDVVAGEAAGLSCRVKHSSLEGQDIVLYWG

Expression System HEK293
Molecular Weight

Predicted MW: 33 kDa Observed MW: 43-55 kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with C-His tag
Physical Appearance Lyophilized Powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

CD1D is a non-classical MHC class I-like glycoprotein specializing in lipid antigen presentation to T cells, particularly natural killer T (NKT) cells. Unlike classical MHC molecules, it presents lipid and glycolipid antigens via a unique binding groove. Expressed on antigen-presenting cells, CD1D bridges innate and adaptive immunity by activating NKT cells to secrete cytokines, influencing responses to infections, autoimmunity, and cancer. Genetic variants are associated with diseases like type 1 diabetes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 41691599076

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
N
Verified Purchase
Natures Retreat
New York, US
★★★★★ 3
Dog likes it
Flavor Name: Marshmallow & Peanut Butter, Size: Large
It wears faster on the longer side, my dog does love this, but 2 sides are not chewed as much.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 19, 2025
S
Verified Purchase
slz
Belleville, US
★★★★★ 5
Terrific! Much easier to use than Kongs and my dog loves it.
Flavor Name: Peanut Butter, Size: Medium
I like these so much better than the original Kongs. The large opening makes it so much easier to put peanut butter or cream cheese into it. Plus much easier to clean out afterwards. My dog also likes to chew it and play with it throwing it in the air after he’s done eating the peanut butter. Very sturdy - he chews apart stuffed toys but his chewing hasn’t damaged this at all. I highly recommend this product!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 9, 2025
T
Verified Purchase
T Wolf
Alexandria, US
★★★★★ 5
Great for strong chewing dogs. Entertaining too!
Flavor Name: Peanut Butter, Size: Medium
My black lab can destroy the toughest of dog chew toys, but he's not destroyed this peanut. I fill it with peanut butter, yogurt, pumpkin or apple sauce and freeze it. It keeps him entertained for quite a while. When the filling is gone, he leaves it alone or carries it around begging for a filled one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 31, 2026
H
Verified Purchase
Heather Murphy
Battle Creek, US
★★★★★ 5
Super cute! If you have one dog it'll last a while. If you have more than one...buy two.
Flavor Name: Marshmallow & Peanut Butter, Size: Large
This is THE FAVORITE chew toy in our household. We have two grown labs and a 10 month old mutt and they all love this toy. They got a variety of chew toys at Christmas and this is the one that they steal from each other. That said, they've definitely managed to kill it. It's well worth the money and it's held up well to heavy chewers but four months later and we're going to have to buy a new one. It's now a stub. They managed to break off all the marshmallows about a week ago and the stick itself is more like a chunk now but we definitely got our money's worth.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 1, 2025
A
Verified Purchase
AvidShopper333
San Leandro, US
★★★★★ 5
Lasting 6 months in! Great smell.
Flavor Name: Marshmallow & Peanut Butter, Size: Large
This actually does smell like marshmallows which is definitely more pleasant than most dog chews!! It has held up to our power chewer. It’s a bit heavy for our smaller dog but he manages and it’s quite funny!! It’s a bit hard but that’s why it is holding up. Would buy again if this one ever wears out.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 3, 2026

recommand products