SKU: 42227630612

Human GFRAL Protein, His Tag

Sale price$63.00 Regular price$70.00
Save 10%

Pay in installments of $17.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human GFRAL Protein, His TagProduct Specification Species Human Synonyms GFRAL, C6orf144 Accession Q6UXV0 Amino Acid Sequence Protein sequence (Q6UXV0, Ser19 Glu351, with C His Tag)

Product Specification


Species Human
Synonyms GFRAL, C6orf144
Accession Q6UXV0
Amino Acid Sequence

Protein sequence (Q6UXV0, Ser19-Glu351, with C-His Tag) SQTNNCTYLREQCLRDANGCKHAWRVMEDACNDSDPGDPCKMRNSSYCNLSIQYLVESNFQFKECLCTDDFYCTVNKLLGKKCINKSDNVKEDKFKWNLTTRSHHGFKGMWSCLEVAEACVGDVVCNAQLASYLKACSANGNPCDLKQCQAAIRFFYQNIPFNIAQMLAFCDCAQSDIPCQQSKEALHSKTCAVNMVPPPTCLSVIRSCQNDELCRRHYRTFQSKCWQRVTRKCHEDENCISTLSKQDLTCSGSDDCKAAYIDILGTVLQVQCTCRTITQSEESLCKIFQHMLHRKSCFNYPTLSNVKGMALYTRKHANKITLTGFHSPFNGE

Expression System HEK293
Molecular Weight Predicted MW: 39.5 kDa Observed MW: 35-45 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

GFRAL is a receptor primarily expressed in the hindbrain and binds to the hormone GDF15. It plays a key role in metabolic regulation, mediating appetite suppression and body weight control in response to stress, inflammation, or disease. GFRAL activation triggers downstream signaling through the RET coreceptor, influencing energy homeostasis. Its association with GDF15 has made it a potential therapeutic target for obesity and metabolic disorders.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 42227630612

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Verified Purchase
Grma4m&m
Grantham, US
★★★★★ 5
They’re fantastic!!!!
Size: X-Large, Color: Multicoloured E-(5-pack)
My clothing size is 16/18 and XL. Even though Amazon suggested a size XXL, I ordered my normal XL and they fit perfectly. The fabric for this style is 92% bamboo viscose and is amazingly soft and almost silky feeling. I had ordered a different boy short in this brand but they were 80% bamboo viscose and the fabric was significantly heavier. I returned those and ordered these.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 25, 2026
K
Verified Purchase
Kay Hairston
Lowell, US
★★★★★ 5
this is my go to when needing new underwear.
Size: 3X-Large, Color: Black/Navy/Dark Purple/Red
Love these boyshorts for women. They're so comfortable, no crawling and breathable. I recommend for plus size women who has legs rubbing together causing irritation. Nice price as well. This is my go to when needing new underwear.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
D
Verified Purchase
Diane
Los Angeles, US
★★★★★ 5
Great!
Size: Small, Color: Black/Heather Gray/White/Nude
Comfy, good fit, good quality cotton and flat seams around the crotch. Normal size small. I wouldn’t wear these with yoga pants, but nice under looser fitting garments. I would buy more colors.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 28, 2026
A
Verified Purchase
Arsenio Braga
San Leandro, US
★★★★★ 5
There is a seam up the front. I think perhaps it being seamless would be better.
Size: Medium, Color: Black
Like anything off Amazon I wasnt expecting anything perfect and ready to have to mail it back. Pleasantly surprised by the softness and durability. The waist band isn't to small on a medium so it fits actually so comfy. I wear them as underwear and as shorts for my skirts n dresses. Id recommend but I say size up if you want a comfy fit. But down if you want a fitted fit fit. Comfy still is fitted but better feeling on if that makes sense. Also the crotch of the shorts/undies has essentially extra fabric sewed in creating that nice comfort. Ill snag a photo when I have time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
S
Verified Purchase
Stephanie Vaughn
Waukegan, US
★★★★★ 4
Product varies from package to package
Size: X-Large, Color: Black/Navy/Dark Purple/Red
Over a two year period this is my 4th purchase. They started as sleep shorts and have replaced other underwear most of the time because they are comfortable and the quality is pretty good. However there are differences in between every package. The length has varied up to an inch, the material has changed, and some are slightly tighter than others. That said it works for me. I am a side sleeper and sometimes the side seam bothers me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 9, 2026

recommand products