SKU: 42383434713

Mouse VEGF-A Protein, His Tag

Sale price$117.00 Regular price$130.00
Save 10%

Pay in installments of $32.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse VEGF-A Protein, His TagProduct Specification Species Mouse Synonyms VEGF164, Vascular permeability factor (VPF), VEGF 1, VEGF164 Accession Q00731 2 Amino Acid Sequence Protein sequence (Q00731 2, Ala27 Arg190, with N His tag) APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR Expression System HEK293 Molecular Weight Predicted MW: 21 kDa Observed MW: 25 30 kDa

Product Specification


Species Mouse
Synonyms VEGF164, Vascular permeability factor (VPF), VEGF-1, VEGF164
Accession Q00731-2
Amino Acid Sequence

Protein sequence (Q00731-2, Ala27-Arg190, with N-His tag) APTTEGEQKSHEVIKFMDVYQRSYCRPIETLVDIFQEYPDEIEYIFKPSCVPLMRCAGCCNDEALECVPTSESNITMQIMRIKPHQSQHIGEMSFLQHSRCECRPKKDRTKPENHCEPCSERRKHLFVQDPQTCKCSCKNTDSRCKARQLELNERTCRCDKPRR

Expression System HEK293
Molecular Weight Predicted MW: 21 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag with N-His tag
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

VEGFA is a key signaling protein that stimulates angiogenesis (blood vessel formation) and vascular permeability. Produced by various cell types, it binds to receptors VEGFR-1 and VEGFR-2, promoting endothelial cell proliferation, migration, and survival. Overexpressed in tumors, VEGFA supports cancer growth and metastasis by enhancing blood supply. It is a major target in anti-angiogenic cancer therapies, with drugs like bevacizumab (Avastin) blocking its activity. VEGFA also plays critical roles in wound healing and inflammatory diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 42383434713

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Cristy L. Spencer
Draper, US
★★★★★ 5
Perfect for my mid size pit bull
Color: Ultra, Size: XL
Updating my review, the ball only lasted 5 days. I left the 5 stars because we had enough fun those 5 days to be worth the small price. She has dog has a lot of jaw strength, so I’m not surprised We have a mid size foster pit bull. This ball is her favorite toy. It’s durable and the perfect size for her to play ball safely.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 22, 2026
C
Verified Purchase
cassidy y
Louisville, US
★★★★★ 5
Good quality
Color: Ultra, Size: Large, Color: Ultra, Size: Large
Great quality. I purchased for my daughter’s dog who destroys all toys. This toy holds up. I didn’t realize it was a large and the chickit stick she had was a medium. The large ball ended up working out good for playing inside the house. The dog likes it a lot.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
M
Verified Purchase
Mindhealer
Lexington, US
★★★★★ 4
Please read!
Color: Ultra, Size: Large
This dog ball is so useful! We have a large property and we use the Chuckit! thrower with the ball. The color and material of the toy is very high-quality and lasts for a long time. We have been using the Chuckit! brand for a long time now and we love their dog products! It is a good price and we buy replacement balls like once or twice every 6 months because they keep getting lost in bushes or trees 😂 After some time the color of the ball gets washed out and since our dogs are aggressive chewers, one of the balls we got broke and split open, but it was still usable! The reason that one broke is because we had it for a HECKA LONG TIME! It has no squeaker so when your dog has the ball it wont make any loud and annoying sounds. It is easy to pick up with the thrower and it seems durable and sturdy enough to last them a few months. I don't recommend as a cat toy because this ball is specifically designed for dogs. But is your cat likes fetch i guess it could work! The ball is soft enough to not be hard as steel, but is sturdy enough to not break immediately.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 9, 2025
H
Verified Purchase
Hayleysgirl
San Leandro, US
★★★★★ 5
Chuck-it stands up to huskies teeth.
Color: Ultra, Size: Large
This item is awesome. Stands up to my huskies teeth.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026
D
Verified Purchase
D.G.
Carnegie, US
★★★★★ 5
Great ball!
Color: Ultra, Size: Large
Our puppy loves this ball. It has held up well so far, it’s about 2 weeks now of large breed pup play. It’s been outside for the last week, rain or shine, still in working order. Not as big as I thought it would be though. No squeak, bounces well. Thick rubber like material, that can be depressed when biting down.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 14, 2026

recommand products