Pay in installments of $28.12 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 13 - Aug 18
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Mouse GR-1 (Ly-6G), His tagProduct Specification Species Mouse Synonyms Lymphocyte antigen 6G, Ly 6G. 1 Accession P35461 Amino Acid Sequence Protein sequence (P35461, Leu27 Asn105, with C 10*His) LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 10. 3 kDa Observed MW: 11, 17 19 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance Lyophilized Powder
Product Specification
| Species | Mouse |
| Synonyms | Lymphocyte antigen 6G, Ly-6G.1 |
| Accession | P35461 |
| Amino Acid Sequence | Protein sequence (P35461, Leu27-Asn105, with C-10*His) LECYNCIGVPPETSCNTTTCPFSDGFCVALEIEVIVDSHRSKVKSNLCLPICPTTLDNTEITGNAVNVKTYCCKEDLCNGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 10.3 kDa Observed MW: 11, 17-19 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Lymphocyte antigen 6G (Ly6G) is a 21-25 kDa glycosyolphosphatidylinositol-anchored protein that is predominatly expressed in granulocytes in bone marrow. Ly6G is a member of the so called Ly6/uPAR family of GPI-anchored surface proteins. Only encoded in mice, Ly6G shows structural and functional similarities to another Ly6/uPAR family member, CD177, which is expressed specifically on both human and mouse neutrophils. Ly6G is a homolog of the human CD177 protein, which has been shown to interact with cell adhesion molecules, and serves as a bona fide marker for neutrophils in mice. Ly6G contributes to the early engagement of intracellular pathogens by the immune system.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy