Pay in installments of $19.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 13 - Aug 18
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Protein A/G-CysProduct Specification Synonyms rProtein A G Cys Amino Acid Sequence
Product Specification
| Synonyms | rProtein A/G-Cys |
| Amino Acid Sequence | NAAQHDEAQQNAFYQVLNMPNLNADQRNGFIQSLKDDPSQSANVLGEAQKLNDSQAPKADAQQNNFNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQAPKADNNFNKEQQNAFYEILNMPNLNEEQRNGFIQSLKDDPSQSANLLSEAKKLNESQAPKADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKADNKFNKEQQNAFYEILHLPNLTEEQRNGFIQSLKDDPSVSKEILAEAKKLNDAQAPKEEDSLEGSGSGTYKLILNGKTLKGETTTEAVDAATAEKVFKQYANDNGVDGEWTYDDATKTFTVTEKPEVIDASELTPAVTTYKLVINGKTLKGETTTKAVDAETAEKAFKQYANDNGVDGVWTYDDATKTFTVTEC |
| Expression System | E.coli |
| Molecular Weight | Approximately 48.0 kDa. |
| Purity | ＞97% by SDS-PAGE or HPLC. |
| Conjugation | Unconjugated |
| Tag | No Tag |
| Physical Appearance | Liquid |
| Storage Buffer | 20 mM PB, with 400 mM NaCl, pH 7.4. |
| Reconstitution | Before use this product, please read the direction below carefully. This vial must be briefly centrifuged prior to opening to bring the contents to the bottom. Stock solutions should be apportioned into working aliquots and stored at ≤ -20℃. Further dilutions should be made in appropriate buffered solutions |
| Stability & Storage | For long term storage, the product should be stored ≤ -20℃. |
Background
The recombinant Protein A/G-Cys is a genetically engineered protein containing 5 IgG-binding regions of protein A and 2 of protein G. Additionally there is a C-terminal cysteine for Site-Specific Conjugation. Cell wall binding region, cell membrane binding region and albumin binding region have been removed from the recombinant A/G-Cys to ensure the maximum specific IgG binding. The recombinant Protein A/G-cys is ideal for making affinity gel to purification of polyclonal or monoclonal IgG antibodies. Protein A/G binds to various human, mouse and rat IgG subclasses (e.g., human IgG1, IgG2, IgG3, IgG4; mouse IgG2a, IgG2b, IgG3; rat IgG2a, IgG2c) . It also binds to total IgG from cow, goat, sheep, house, rabbit, guinea pig, pig, dog and cat.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy