SKU: 51819857574

Human L-selectin, His tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human L-selectin, His tagProduct Specification Species Human Synonyms CD62 antigen like family member L, Leukocyte adhesion molecule 1 (LAM 1), Leukocyte surface antigen Leu 8, Leukocyte endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90 MEL, SELL, LNHR, LYAM1 Accession P14151 Amino Acid Sequence Protein sequence (P14151, Trp39 Val194, with C 10*His)

Product Specification


Species Human
Synonyms CD62 antigen-like family member L, Leukocyte adhesion molecule 1 (LAM-1), Leukocyte surface antigen Leu-8, Leukocyte-endothelial cell adhesion molecule 1 (LECAM1), Lymph node homing receptor, TQ1, gp90-MEL, SELL, LNHR, LYAM1
Accession P14151
Amino Acid Sequence

Protein sequence (P14151, Trp39-Val194, with C-10*His) WTYHYSEKPMNWQRARRFCRDNYTDLVAIQNKAEIEYLEKTLPFSRSYYWIGIRKIGGIWTWVGTNKSLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWNDDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCNCDVGYYGPQCQFVGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 19.9 kDa Observed MW: 24, 26-33 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

L-selectin, also known as CD62L, is a cell adhesion molecule found on the cell surface of leukocytes, and the blastocyst. L-selectin belongs to the selectin family of proteins, which recognize sialylated carbohydrate groups containing a Sialyl LewisX (sLeX) determinant. L-selectin plays an important role in both the innate and adaptive immune responses by facilitating leukocyte-endothelial cell adhesion events. L-selectin is also expressed by lymphoid primed hematopoietic stem cells and may participate in the migration of these stem cells to the primary lymphoid organs. L-selectin is expressed on embryonic cells and facilitates the attachment of the blastocyst to the endometrial endothelium during human embryo implantation. It is cleaved by ADAM17. L-selectin expressed on CD4 T lymphocytes has been implicated in mediating adhesion and entry of HIV. Deficiency epithelial expression of L-selectin ligands has been associated with infertility, while increased expression has been implicated in ectopic pregnancies. The adhesive properties of L-selectin have been shown to contribute to cancer progression.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 51819857574

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
W
Verified Purchase
W. Dietrich
Belleville, US
★★★★★ 5
Great Toy For a Great Price
Color: Purple
My Aussie loves toys and plays with them as though she is a small child. She has a basket and will go to the basket and dig through it until she finds what she is looking for. Lately she has been using the bungee gecko as her toy of choice. She gets bored easily and will rip the stuffing out of most toys, the fact that this one has lasted 6 weeks or so is impressive with no rips, holes or missing limbs. Her favorite way to play is to come over to me and nudge me to play tug of war and we have broke many toys this way but so far we can play tug a war several minutes at a time and the gecko is still in one piece. For the price which is considerable less than some of her other toys I have already ordered a couple of replacements for the future. This is a great well built dog toy that has has a lot of give and can be stretched without ripping.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2013
Y
Verified Purchase
ynk
Alexandria, US
★★★★★ 3
No longer as durable
Color: Purple
I have one of these that has made it through 2 dogs but now the bungee is stretched out. It's been such a well loved toy I recently got another one. They've changed the plush fabric. The old one was indestructible. This new one is much thinner and easily torn. I wish they would go back to the old plush fabric.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 4, 2024
D
Verified Purchase
Donna
Boise, US
★★★★★ 5
Great Toy!
Color: Orange
This has been a great toy for our 11 week old German Shepherd. She absolutely loves it. I can get out all of her toys and lay them out with the exception of her "Lizzy" and she will immediately go to her toy bin and get it herself. Needless to say it is her favorite toy. She has had it a week now and she plays with it a lot, chewing and squeaking. It's a pretty amazing toy to have held up this long already and to date shows no sign of wear or damage. Lizzy just keeps going and going.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 4, 2014
A
Verified Purchase
Anna Rita
Lake Worth, US
★★★★★ 1
This item came with plush missingand thread unraveling on one leg
Color: Blue
I bought this toy because my dog spent a week playing with the same toy from Zanies that belonged to a visiting dog. My dog was very gentle with this toy, which he loved, so we decided to find one for him. The toy that arrived had no Zanies label and missing plush on the bottom where the label should have been, plus other bare spots in the area that showed the white mesh beneath. It also had a long thread at the joint of a rear leg so I knotted it at the joint and clipped it to prevent my dog from pulling at it but it's apparent that the sewing is loose and wont last long. The color was also much lighter than the toy he'd been playing with that belonged to the guest dog but I figured it might just be from a different dye lot (it was not bought at Amazon but their local pet store.) I am not convinced this is a real Zanies toy. There were two labels in French and it said it was made in China. I am returning this toy and will get a replacement and see how it looks. If it seems like it will fall apart or is not the real thing I will return it immediately. If it has a label and is in good shape and sewn well at the seams I'll revise this review.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 4, 2020
N
Verified Purchase
Neil Ginsberg
West Palm Beach, US
★★★★★ 5
Fantastic Dog Toy!!!
Color: Purple
This is a great toy!!! My dog has lots of toys. But one of the problems is he has trouble getting the squeaker to squeak. He's an 18 lb terrier mix, and those squeakers are just elusive. Breaks my heart. This one, though, the squeakers (there are two) are in small areas (head and tail), that are easy for him to get his whole mouth around and squeak. They also don't move, which also makes them easy to squeak. So he's been squeaking up a storm since he got this! Other plusses: * The material is great (soft, furry material, that seems to be of good quality). * The toy expands and contracts, which is fun. * It's pleasant to look at. All in all, I'd say this is one of the best dog toys I've ever bought for my dog. Highly recommended!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 11, 2015

recommand products