SKU: 52962445347

Human CD127, His tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD127, His tagProduct Specification Species Human Synonyms CDw127 Accession P16871 Amino Acid Sequence Protein sequence (P16871, Glu21 Asp239, with C 10*His) ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 26. 9 kDa Observed

Product Specification


Species Human
Synonyms CDw127
Accession P16871
Amino Acid Sequence

Protein sequence (P16871, Glu21-Asp239, with C-10*His) ESGYAQNGDLEDAELDDYSFSCYSQLEVNGSQHSLTCAFEDPDVNITNLEFEICGALVEVKCLNFRKLQEIYFIETKKFLLIGKSNICVKVGEKSLTCKKIDLTTIVKPEAPFDLSVVYREGANDFVVTFNTSHLQKKYVKVLMHDVAYRQEKDENKWTHVNLSSTKLTLLQRKLQPAAMYEIKVRSIPDHYFKGFWSEWSPSYYFRTPEINNSSGEMDGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 26.9 kDa Observed MW: 50 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/ml according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin-7 receptor subunit alpha (IL7R-α) also known as CD127 (Cluster of Differentiation 127) is a protein that in humans is encoded by the IL7R gene. IL7R-α is a type I cytokine receptor and is a subunit of the functional Interleukin-7 receptor and Thymic Stromal Lymphopoietin (TSLP) receptors that plays an important role in lymphocyte differentiation, proliferation, and survival. IL-7 R alpha is expressed on double negative (CD44-/CD8+) and CD4+ or CD8+ single positive T cells as well as on CD8+ memory T cells and their precursors. It is expressed early in B cell development, prior to the appearance of surface IgM. IL-7 induces the downregulation and shedding of cell surface IL‑7 R alpha.IL-7 R alpha additionally associates with TSLP R to form the functional receptor for thymic stromal lymphopoietin.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 52962445347

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 25 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
M
Verified Purchase
Megan R Wesby
Natrona Heights, US
★★★★★ 4
Good budget-friendly option
Color: Black, Size: Pack of 1, Color: Black, Size: Pack of 1
The chair arrived 4 days early and was easy to put together by following the instructions carefully. It feels sturdy and comfortable. It does support the lumbar region of the back and the arm rests are adjustable vertically as well as the head rest. I wish the arm rests were able to rotate in and out for added customization and that the back of the chair could be adjusted up and down for more precise support. But for a budget chair, it does a good job.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 4, 2026
F
Verified Purchase
farmhousewife
Waukegan, US
★★★★★ 5
A solid chair for the budget conscious sitter.
Color: Black, Size: Pack of 1
While this is not THE most comfortable chair, let's face it - if you sit for long periods, what chair IS? I bought this chair because I'm making a career change. I've returned to school and spend hours at my desk. At the age of 50, sitting for a long time with my nose pointed toward a book can be hard on the seat, back and neck. I looked at all kinds of office chairs and settled on this one, primarily because it was on sale, was in my budget and so I clicked the "Add to cart" button and hoped for the best. It was delivered, and I had to work that evening, and when I got home my 17-year-old son had assembled it. My theory on the simplicity of assembly can be deduced from that sentence above. He didn't have any extra parts left over and the chair was complete! I sat down. I leaned back. I shifted the lever that keeps the chair in an upright position and sat straight up. Okay! I can live with this. It has been almost two full months of using this chair and I have no problems. Pros: easy to assemble sufficient comfort level - adequate cushion in the seat can be leaned back or pop the lever in to stay straight up rollers on bottom headrest is adjustable affordable easy to clean arm-rests can be moved up or down height adjustment is self-explanatory - you'll figure it out the "lumbar" support is actually comfortable - it's "there" if you back up to it but if you scoot forward just a bit, you won't feel it if you don't want to sit like that Overall this seems like a chair that's going to last me for a few years, at least, and not fall apart. In the context of size, I'm not a small or extra larger person. I'm an average middle-aged woman with meat on the bones. The seat is plenty big enough. I would recommend this chair as an upgrade to the hand-me-down office chair that just isn't comfortable any longer.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 1, 2023
A
Verified Purchase
Amazon Customer
Chelsea, US
★★★★★ 5
Love this chair!
Color: Black, Size: Pack of 1
I had an office chair that cost $300 more than this chair - had it for years, then things started breaking down on it. I read about this chair and, wow! I wish I had known about it sooner. It's more comfortable and it's not a chore to sit for a couple of hours working on designs. Wonderful design - supports my back well and it's very stable, easy to adjust.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026
R
Verified Purchase
Rogelio Luna
New York, US
★★★★★ 5
Genuine Quality
Color: Black, Size: Pack of 1
Absolutely love this office chair! Super comfortable, sturdy, and easy to adjust. It made a huge difference during long hours at my desk, and the quality feels excellent for the price. Highly recommend!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
J
Verified Purchase
Jon
Boise, US
★★★★★ 3
Good chair with some quality issues
Color: Black, Size: Pack of 1
I've been using this chair for 12+ hours a day for the last 5 or 6 months and so far it is much better than my last chair I bought at Staples with a few problems. First, overall the chair is still comfortable when set properly, the cushion on the bottom is a little worn out but is still comfortable and I find the backrest comfortable except for the lumbar support which has very little cushioning and feels like a plastic brick being pushed into my back, however I find that I can keep it mostly out of the way most of the time and it isn't noticeable when I carry most of my weight on my upper back area while reclining. The reclining angle is super comfortable and the mesh on the back is not noticeably worn out. I like the headrest which is made of a cushioned mesh, its not better than a pillow but it's very comfortable to be able to rest your head in a chair you are going to sit in for long hours and gives good support. The arm rests don't feel amazing, they have a very stiff plasticky cushion feeling that I'm not much a fan of in terms of pure comfort but they get the job done as I mostly only rest my elbows on them when typing. The arm rest adjustment has a pretty good height range and I keep them at the highest settings and set as close to the chair as possible. While the chair may be comfortable, I have had some quality issues that bring down my opinion of the chair. First, my right arm rest does not go as high as my left arm rest and I have to set the left one down two positions to match the right one Second, the back rest locking for the upright position is broken but I can rarely get it to work as long as I don't put much weight on the back. I would imagine that most people would want to lock the chair upright as opposed to the other positions. Third, the 3 screws holding in the backrest untighten themselves over time, causing the backrest to move to its furthest back position and rock left or right if I lean on either side. When I tighten them again they will usually last about 1-2 weeks before becoming mostly loose again. There is no danger of the screws completely falling out though, just losing their tightness Lastly, I'm not sure how stable or secure the wood panel at the bottom of the seat that everything attaches to is strong enough, I used to have my armrests adjusted out further from the center but when I would lift up on my arms to adjust my seating position I would occasionally hear a sound of the wood stressing under the torque from the armrests. since I moved both armrests as close to the center as I can this has not happened; I would like them a little bit wider but I don't want to risk breaking the chair over it. Also, one of the factory-installed screws in the bottom seat panel fell out and wont stay back in but I haven't noticed any problems other than the risk of stepping on a screw caused by it While this is likely the most comfortable chair I've ever sat in, I have to give it 3 stars for the uncomfortable lumbar support and the quality control issues. If the QC issues were fixed I could easily give this chair a 4 star review
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2022

recommand products