SKU: 53846806400

Human CD8, hFc tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human CD8, hFc tagProduct Specification Species Human Synonyms T lymphocyte differentiation antigen T8 Leu 2, MAL Accession P01732 Amino Acid Sequence Protein sequence (P01732, Ser22 Asp182, with C hFc)

Product Specification


Species Human
Synonyms T-lymphocyte differentiation antigen T8/Leu-2, MAL
Accession P01732
Amino Acid Sequence

Protein sequence (P01732, Ser22-Asp182, with C-hFc) SQFRVSPLDRTWNLGETVELKCQVLLSNPTSGCSWLFQPRGAAASPTFLLYLSQNKPKAAEGLDTQRFSGKRLGDTFVLTLSDFRRENEGYYFCSALSNSIMYFSHFVPVFLPAKPTTTPAPRPPTPAPTIASQPLSLRPEACRPAAGGAVHTRGLDFACDEPKSCDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight

Predicted MW: 43.7 kDa Observed MW: 55 kDa

Purity >95% by SDS-PAGE
Tag with C-hFc
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

CD8 (cluster of differentiation 8) is a transmembrane glycoprotein that serves as a co-receptor for the T-cell receptor (TCR). Along with the TCR, the CD8 co-receptor plays a role in T cell signaling and aiding with cytotoxic T cell-antigen interactions. Like the TCR, CD8 binds to a major histocompatibility complex (MHC) molecule, but is specific for the MHC class I protein. There are two isoforms of the protein, alpha and beta. The extracellular IgV-like domain of CD8-α interacts with the α3 portion of the Class I MHC molecule. Cytotoxic T cells with CD8 surface protein are called CD8+ T cells. Once the T cell receptor binds its specific antigen Lck phosphorylates the cytoplasmic CD3 and ζ-chains of the TCR complex which initiates a cascade of phosphorylation eventually leading to activation of transcription factors like NFAT, NF-κB, and AP-1 which affect the expression of certain genes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 53846806400

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 21 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
Tamara
Lake Worth, US
★★★★★ 1
Not worth the price
Size: Medium, Color: Dark Cappuccino
Item was gifted for Christmas. Within 3 weeks stitching was coming out of the straps.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026
C
Verified Purchase
Chasie
Pawtucket, US
★★★★★ 5
Positive
Size: Medium, Color: Dark Cappuccino
The dark cappuccino brown is pretty. This is a favorite just because of the color of the tote. The inside lining color makes it easy to find items. I like it so much I ordered the black one.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 28, 2025
M
Verified Purchase
Mary Eileen Koehler
Omaha, US
★★★★★ 5
Love this bag
Size: One Size, Color: Vintage Patch
Great bag
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 26, 2024
C
Christine Spencer
Bozeman, US
★★★★★ 3
Love the style but it doesn’t hold shape
Size: One Size, Color: Vanilla
I am big fan of the Lucky Brand. This tote disappointed simply because it was floppy. So if you set it down it just collapses instead of holding shape. So it wasn’t what I was looking for in a tote. I was really excited about this bag because I love the style and color. But I ended up returning it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 19, 2026
S
Verified Purchase
S Gardner
San Leandro, US
★★★★★ 5
Super cute… but not what the listing is
Size: One Size, Color: Dark Cappuccino, Size: One Size, Color: Dark Cappuccino
First of all, this listing is entirely inaccurate, as other reviews say, the picture is of a larger bag when in reality you are sent something much smaller and without the small wallet. I wanted the smaller bag, so I ordered it intentionally, but if you are looking for the larger size, do not order this. I included a side by side comparison of the two bags. The lighter bag is the size this listing is supposed to be (that I owned previously) and the smaller one is the one I was sent. That being said the smaller bag is super cute and so similar to the Brooklyn bag! Just be aware that it does not match the listing :)
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 18, 2025

recommand products