Pay in installments of $23.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 14 - Aug 19
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
TNF-α Protein, HumanProduct Specification Species Human Synonyms TNF , Cachectin, Tumor Necrosis Factor Alpha, TNFSF1A Accession P01375 Amino Acid Sequence Val77 Leu233, with N terminal 8*His MHHHHHHHHVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL Expression System E. coli Molecular Weight 18. 5kDa Purity >95% by SDS PAGE Endotoxin <1EU g Conjugation
Product Specification
| Species | Human |
| Synonyms | TNF-α, Cachectin, Tumor Necrosis Factor-Alpha, TNFSF1A |
| Accession | P01375 |
| Amino Acid Sequence | Val77-Leu233, with N-terminal 8*His MHHHHHHHHVRSSSRTPSDKPVAHVVANPQAEGQLQWLNRRANALLANGVELRDNQLVVPSEGLYLIYSQVLFKGQGCPSTHVLLTHTISRIAVSYQTKVNLLSAIKSPCQRETPEGAEAKPWYEPIYLGGVFQLEKGDRLSAEINRPDYLDFAESGQVYFGIIAL |
| Expression System | E.coli |
| Molecular Weight | 18.5kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 150mM NaCl, 2mM TCEP, pH8.5 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage |
· 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Hector J. et al. (2007) TNF-alpha alters visfatin and adiponectin levels in human fat. Horm Metab Res. 39(4): 250-255. 2、Berthold-Losleben M. et al. (2008) The TNF-alpha System: Functional Aspects in Depression, Narcolepsy and Psychopharmacology. Curr Neuropharmacol. 6(3): 193-202. |
Background
Tumor necrosis factor α (TNF alpha) is an effective pro-inflammatory cytokine, which can kill and inhibit tumor cells. It is mainly produced by activated macrophages and can also be secreted by other types of cells, such as CD4+ lymphocytes, NK cells, neutrophils, mast cells, eosinophils and neuronal tissues. The members of TNF alpha family exert their cellular effect through two distinct surface receptors of the TNF receptor family, TNFR1 and TNFR2. The pleiotropic biological effects of TNF can be attributed to its ability to simultaneously activate multiple signaling pathways in cells. TNF-induced NF-κB activation promotes the growth, invasion and metastasis of cancer cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy