Pay in installments of $64.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 15 - Aug 20
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP6 His Tag Protein, HumanProduct Specification Species Human Synonyms ILeal Lipid binding protein Accession P51161 Amino Acid Sequence Met1 Ala128, with N terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA Expression System E. coli Molecular Weight 16kDa (Reducing) Purity 95% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance
Product Specification
| Species | Human |
| Synonyms | ILeal Lipid-binding protein |
| Accession | P51161 |
| Amino Acid Sequence | Met1-Ala128, with N-terminal 8*His MHHHHHHHHMAFTGKFEMESEKNYDEFMKLLGISSDVIEKARNFKIVTEVQQDGQDFTWSQHYSGGHTMTNKFTVGKESNIQTMGGKTFKATVQMEGGKLVVNFPNYHQTSEIVGDKLVEVSTIGGVTYERVSKRLA |
| Expression System | E.coli |
| Molecular Weight | 16kDa (Reducing) |
| Purity | >95% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
FABP6(ILeal Lipid-binding protein, ILBP) is a cytoplasm protein which belongs to the calycin superfamily and Fatty-acid binding protein (FABP) family. It binds mainly to bile acids that are reabsorbed in the ileum. Thus, mice lacking FABP6 do not exhibit a fatty acid metabolic phenotype but are protected against gallstone disease. FABP6 is a cancer-related protein that acts as an intracellular transporter of bile acid in the ileal epithelium. FABP6 may also play an important role in early carcinogenesis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.1 ★★★★★
Based on 6 reviews
Sort
Product Reviews
★★★★★ 4
If you're looking for a budget-friendly option for everyday printing, this is a solid choice.
Size: 1 Ream | 500 Sheets, Style: Letter (8.5x11)
Let's be honest, reviewing copy paper isn't exactly thrilling. But,et's be honest, reviewing copy paper isn't exactly thrilling. But, if you're buying paper, you expect it to, well, work like paper. And in that regard, the Amazon Basics Multipurpose Copy Paper delivers. It works as paper should.
That's really the core of it. This paper is functional. It's the kind of paper you buy when you need a lot of it without breaking the bank. Here's a quick breakdown:
Pros:
Affordable: This is the biggest selling point. If you're looking for a budget-friendly option for everyday printing, this is a solid choice.
Good for High-Volume Printing: Because of its affordability, it's great for those situations where you're churning out documents and don't want to worry about the cost per page.
Works in Most Printers: I've used it in inkjet and laser printers without any major issues. It's generally reliable in terms of feeding and printing.
Acceptable Brightness: It's not the brightest white paper on the market, but it's acceptable for most general-purpose printing.
Cons:
Not Premium Quality: Don't expect a luxurious feel or exceptionally crisp print quality. It's not designed for high-resolution photos or important presentations.
Can Be a Little Thin: Compared to more expensive paper, it can feel a bit thinner. This might lead to slight show-through if you're printing heavily on both sides.
Packaging Can Sometimes Be Damaged: While not always the case, some users have reported damaged packaging upon delivery. This hasn't affected the paper itself in my experience, but it's something to be aware of.
Overall:
The Amazon Basics Multipurpose Copy Paper is a reliable and affordable option for everyday printing needs. It's not fancy, but it gets the job done. If you're looking for premium quality, look elsewhere. But if you just need a lot of paper, that works as paper should, and at a good price, this is a worthwhile choice.
That's really the core of it. This paper is functional. It's the kind of paper you buy when you need a lot of it without breaking the bank. Here's a quick breakdown:
Pros:
Affordable: This is the biggest selling point. If you're looking for a budget-friendly option for everyday printing, this is a solid choice.
Good for High-Volume Printing: Because of its affordability, it's great for those situations where you're churning out documents and don't want to worry about the cost per page.
Works in Most Printers: I've used it in inkjet and laser printers without any major issues. It's generally reliable in terms of feeding and printing.
Acceptable Brightness: It's not the brightest white paper on the market, but it's acceptable for most general-purpose printing.
Cons:
Not Premium Quality: Don't expect a luxurious feel or exceptionally crisp print quality. It's not designed for high-resolution photos or important presentations.
Can Be a Little Thin: Compared to more expensive paper, it can feel a bit thinner. This might lead to slight show-through if you're printing heavily on both sides.
Packaging Can Sometimes Be Damaged: While not always the case, some users have reported damaged packaging upon delivery. This hasn't affected the paper itself in my experience, but it's something to be aware of.
Overall:
The Amazon Basics Multipurpose Copy Paper is a reliable and affordable option for everyday printing needs. It's not fancy, but it gets the job done. If you're looking for premium quality, look elsewhere. But if you just need a lot of paper, that works as paper should, and at a good price, this is a worthwhile choice.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 27, 2025
★★★★★ 5
Reliable Everyday Printer Paper
Size: 1 Ream | 500 Sheets, Style: Letter (8.5x11)
This is standard plain printer paper for everyday home use, and it does exactly what it’s supposed to do without any issues. I have had no problems with paper jams, ink smudging, or feeding through the printer.
The paper is an average thickness, nothing special, but perfectly fine for printing documents. The color is white. It does not curl, and everything comes out clean and readable. It does not stand out in any particular way, but there is also nothing to complain about. Overall, it is reliable, consistent, and works well for regular home printing needs. I will buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 29, 2026
★★★★★ 5
Good price. Good paper.
Size: 8 Reams | 4000 Sheets, Style: Letter (8.5x11)
I feel like I have purchased this paper a hundred times. I have it on subscription. It works great in all my printers.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2026
★★★★★ 5
Love it.
Style: Ink
I love my epson workforce printer. I used to be a Canon person but once I got this printer. It changed my mind. So the ink is worth it. Especially in the bundle package. It may be a bit on the pricey side but it last me awhile. At least, in my opinion, it’s less expensive than buying them separately. Epson makes great stuff and glad I chose to stick with them. The ink is very good and looks great after it prints. Thanks to Epson for functionality, cost and efficiency when it comes you your products.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 10, 2025
★★★★★ 5
Epson Ink for the win
Style: Ink
Love my epson printer and that I can order the ink just about anywhere. Ink is of good quality and depending on the amount you print, it seems to last a decent amount of time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 28, 2026