Pay in installments of $27.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 16 - Aug 21
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human Parvalbumin, His tagProduct Specification Species Human Synonyms PVALB Accession P20472 Amino Acid Sequence Protein sequence (P20472, Met1 Ser110, with C 10*His) MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAESGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight Predicted MW: 13. 7 kDa Observed MW: 13. 7 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Tag with C 10*His Physical Appearance Lyophilized Powder
Product Specification
| Species | Human |
| Synonyms | PVALB |
| Accession | P20472 |
| Amino Acid Sequence | Protein sequence (P20472, Met1-Ser110, with C-10*His) MSMTDLLNAEDIKKAVGAFSATDSFDHKKFFQMVGLKKKSADDVKKVFHMLDKDKSGFIEEDELGFILKGFSPDARDLSAKETKMLMAAGDKDGDGKIGVDEFSTLVAESGGGGSHHHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | Predicted MW: 13.7 kDa Observed MW: 13.7 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Parvalbumin (PV) is a calcium-binding protein with low molecular weight. It is encoded by the PVALB gene. It has three EF hand motifs and is structurally related to calmodulin and troponin C. Parvalbumin is found in fast-contracting muscles, where its levels are highest, as well as in the brain and some endocrine tissues. Calcium binding proteins like parvalbumin play a role in many physiological processes, namely cell-cycle regulation, second messenger production, muscle contraction, organization of microtubules and phototransduction. Decreased PV and GAD67 expression was found in PV+ GABAergic interneurons in schizophrenia. Parvalbumin has been identified as an allergen causing fish allergy (but not shellfish allergy). Bony fishes manifest β-parvalbumin and cartilaginous fishes such as sharks and rays manifest α-parvalbumin; allergenicity to bony fishes has a low cross-reactivity to cartilaginous fishes.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy