Pay in installments of $40.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 16 - Aug 21
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP2 His Tag Protein, HumanProduct Specification Species Human Accession P12104 Amino Acid Sequence Met1 Asp132, with C terminal 8*His MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDHHHHHHHH Expression System E. coli Molecular Weight 16. 5kDa (Reducing) Purity 98% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer
Product Specification
| Species | Human |
| Accession | P12104 |
| Amino Acid Sequence | Met1-Asp132, with C-terminal 8*His MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | 16.5kDa (Reducing) |
| Purity | ＞98% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
FABP2 is expressed solely in the small intestine, and may control development of the small intestine particularly in response to diet. FABP2 null animals were shown to be resistant to high fat diet induced obesity. FABP2 KO mice fed a high saturated fat low fiber diet showed reduced intestinal villi length and increased transit time, as well as decreased goblet cell density and paneth cell number. Epidemiological studies have long shown that the common Ala54Thr FABP2 polymorphism in humans is associated with metabolic syndrome. The Thr54 FABP was shown to have a slightly higher affinity than the Ala54 containing protein, and human fetal intestinal explants showed that subjects with the Thr54 polymorphism had increased levels of chylomicron secretion . Thus while the complete molecular mechanisms linking these biochemical and cellular observations to the population-based observations remain to be revealed, nutritional intervention strategies may prove helpful in treating metabolic syndrome in Ala54Thr carriers.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.4 ★★★★★
Based on 13 reviews
Sort
Product Reviews
★★★★★ 3
It’s cute, but it’s dry glitter dust. I thought it would be moist to stay on skin.
Color: Sparkling Pink, Color: Sparkling Pink
Just dry glitter dust. I thought it would be moist to stay on skin.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026
★★★★★ 5
Great coverage, easy to apply
Color: Glint-Rainbow
This has amazing coverage. Was skeptical at first. I thought the little puffer applicator would not work well. It does however work Very! Well! Would buy again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 26, 2026
★★★★★ 5
Lovely
Color: Silver White - 02, Color: Silver White - 02
This is the best body glitter I have ever owned. I have a spray one and it is not as shiny as this one. This one has a very good appearance. It literally is shining so bright without the lights being off. This is one drop on my hand that I spread around, it does go on as a liquid and then it dries up and soak in your skin . From the bottle It has a very fresh scent like a very, very light scent, but when you put on your skin, it doesn’t smell like anything so you can still put on your regular perfume without worrying about mixing fragrances. It’s a good decent size especially considering I only did one drop and I get so much glitter!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 7, 2026
★★★★★ 5
Perfect Champagne Shimmer for Festivals & Events
Color: Champagne Gold - 01
Color- Champagne Gold shade.
So cute! Get it! I always end up getting compliments when I wear this to festivals/concerts/event. It works great not just on your face but all over your body like arms, chest, shoulders, anywhere you want a little extra glow. It adds a really cute shimmer without being too extreme or over-the-top. I especially like wearing it to festivals or events where there are lots of lights or sunshine, because that’s when it really catches the light and looks the best.
Once it dries, it has more of a matte finish with a soft shimmer rather than looking overly dewy or greasy. The champagne color blends really nicely with my neutral/tan skin tone, so it looks natural while still adding that fun sparkle. It’s a great little addition to any festival or event outfit.
A little bit goes a long way. I’ve probably used this around 20 times already and still have at least half the bottle left. Another huge plus is that it washes off easily and doesn’t flake everywhere or leave glitter all over the floors and counters like some other body glitters I’ve tried. Overall, a great product if you want a subtle but noticeable shimmer! ✨
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 6, 2026
★★★★★ 5
Buy it!
Color: Champagne Gold - 01
I love the glitter on my body, it stays and is not sticky! But does get everywhere I touch haha
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2026
recommand products
Protein Power Recipes - 102 Healthy Meals, Breakfasts, Smoothies, Eggs, Seafood, One Dish Dinners, Chicken, Slow Cooker Stews, Burgers, Grilling, Party Food, Vegetarian & Plant-Based Alternatives!
13.99
Kami Wooden Mug
62.00
NEW Kiso Lifestyle Labo Hinoki Bath Aroma
18.00
Outdoor Plants - Comprehensive Guide: How To Plan, Plant, Trim, Nurture, Pollinate, Feed, Watering Systems, Protect From Insects, Geographic Zones, Soil, Climate, Landscaping, Tools, Weeding & More!
13.99
Madame Web - Fan Guide: Spider-Man's Ally, Girl Power, Dakota Johnson, Sydney Sweeney, Emma Roberts, Adam Scott, Characters, BTS, New Marvel Films & TV, Sneak Peaks, Deadpool, Ironheart, Blade & MCU!
13.99