Pay in installments of $37.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 16 - Aug 21
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Canis lupus familiaris CD64, His tagProduct Specification Species Canis lupus familiaris Synonyms High affinity IgG Fc gamma receptor 1, FcgammaRI Accession Q7YQJ5 Amino Acid Sequence Protein sequence (Q7YQJ5, Gln16 Pro288, with C 10*His)
Product Specification
| Species | Canis lupus familiaris |
| Synonyms | High affinity IgG Fc gamma receptor 1, FcgammaRI |
| Accession | Q7YQJ5 |
| Amino Acid Sequence | Protein sequence (Q7YQJ5, Gln16-Pro288, with C-10*His) QTDPVKAVITLQPPWVSVFQEESVTLWCEGPHLPGDSSTQWFLNGTATQTLTPRYRIAAASVNDNGEYRCQTGLSVLSDPIQLGIHRDWLILQVSGRVFTEGEPLTLRCHGWNNKLVYNVLFYQNGTVLKFSPQNSEFTILKTTLHHNGIYHCSAMGKHRYESAGVSITIKELFPAPVLKASLSSPILEGHVVNLSCETKLLLQRPGLQLYFSFYMGSKTLLSRNTSSEYQILTAKKEDSGLYWCEATTEDGNVVKRSPELELQVVGPQTLTPGGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 32.2 kDaObserved MW: 33, 40, 45 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Tag | with C-10*His |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
CD64 (Cluster of Differentiation 64) is a type of integral membrane glycoprotein known as an Fc receptor that binds monomeric IgG-type antibodies with high affinity. It is more commonly known as Fc-gamma receptor 1 (FcγRI). After binding IgG, CD64 interacts with an accessory chain known as the common γ chain (γ chain), which possesses an ITAM motif that is necessary for triggering cellular activation. Structurally CD64 is composed of a signal peptide that allows its transport to the surface of a cell, three extracellular immunoglobulin domains of the C2-type that it uses to bind antibody, a hydrophobic transmembrane domain, and a short cytoplasmic tail. CD64 is constitutively found on only macrophages and monocytes, but treatment of polymorphonuclear leukocytes with cytokines like IFNγ and G-CSF can induce CD64 expression on these cells.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy