SKU: 80812290973

USP11 Protein

Sale price$162.00 Regular price$180.00
Save 10%

Pay in installments of $45.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

USP11 ProteinProduct Specification Species Human Antigen USP11 Synonyms HX1,Deubiquitinating enzyme 11, Ubiquitin carboxyl terminal hydrolase 11,Ubiquitin specific peptidase 11,Ubiquitin specific protease 11 Accession P51784 Amino Acid Sequence Asp67 Glu300, with N terminal 8*His

Product Specification


Species Human
Antigen USP11
Synonyms HX1,Deubiquitinating enzyme 11, Ubiquitin carboxyl-terminal hydrolase 11,Ubiquitin specific peptidase 11,Ubiquitin specific protease 11
Accession P51784
Amino Acid Sequence

Asp67-Glu300, with N-terminal 8*His HHHHHHHHDREPQHEELPGLDSQWRQIENGESGRERPLRAGESWFLVEKHWYKQWEAYVQGGDQDSSTFPGCINNATLFQDEINWRLKEGLVEGEDYVLLPAAAWHYLVSWYGLEHGQPPIERKVIELPNIQKVEVYPVELLLVRHNDLGKSHTVQFSHTDSIGLVLRTARERFLVEPQEDTRLWAKNSEGSLDRLYDTHITVLDAALETGQLIIMETRKKDGTWPSAQLHVMNNNMSEEDE

Expression System E.coli
Molecular Weight

28kDa (Reducing)

Purity >95% by SDS-PAGE&HPLC
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution

Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.

Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied; 6 months, -20 to -70 °C under sterile conditions after reconstitution; 1 week, 2 to 8 °C under sterile conditions after reconstitution; Please avoid repeated freeze-thaw cycles.

Reference

1. Haruko Ideguchi, et al. (2002) C Structural and functional characterization of the USP11 deubiquitinating enzyme, which interacts with the RanGTP-associated protein RanBPM. Biochem J. 1;367(Pt 1):87-95.
2. Key-Hwan Lim, et al. (2016) Ubiquitin-specific protease 11 functions as a tumor suppressor by modulating Mgl-1 protein to regulate cancer cell growth. Oncotarget. 22;7(12):14441-57.

Background

USP11 is also named as UHX1 and belongs to the peptidase C19 family. It is a deubiquitinating enzyme that controls many intracellular processes, including cell cycle progression, transcriptional activation, and signal transduction. USP11 as a novel regulator of Mgl-1 and it requires RanBPM to regulate proteasomal degradation of Mgl-1. USP11 showed deubiquitinating activity and stabilized Mgl-1 protein. However, USP11-mediated Mgl-1 stabilization was inhibited in RanBPM-knockdown cells. Furthermore, in the cancer cell migration, the regulation of Mgl-1 by USP11 required RanBPM expression. In addition, an in vivo study revealed that depletion of USP11 leads to tumor formation. Taken together, the results indicated that USP11 functions as a tumor suppressor through the regulation of Mgl-1 protein degradation via RanBPM. USP11 may be a ubiquitous protein in various human tissues. By immunofluorescence assay, USP11 primarily was localized in the nucleus of non-dividing cells, suggesting an association between USP11 and RanBPM in the nucleus. Furthermore, the association between USP11 and RanBPM in vivo was confirmed not only by yeast two-hybrid assay but also by co-immunoprecipitation assays using exogenously expressed USP11 and RanBPM.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 80812290973

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 26 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
G
Grammar Guru
Charlottesville, US
★★★★★ 5
Very nice kit: Beware it is NOT heavy duty plumbing pipe though!
Size: side table leg
I want to give this kit a high rating, but I need to address the "truth in advertising" bit since there may be an important disconnect between what you think you are getting and what actually comes in the box. Black plumbing used for shelving or table legs is part of an important niche in interior design. I like the industrial loft look myself and have a variety of glass, steel, and masonry elements in my home. This kit fits that look and provides plenty of "strength" for most domestic uses, like shelves or coffee tables. But they are NOT "industrial pipe" or "maximum durability pipe." Note the phrase "cast iron finish feet," which together with the other claims might lead you to think these are cast plumbing fittings. They are NOT! The feet and flanges feel like electrical conduit fittings, and the pipe sections are likely aluminum. They might be electrical or they might be multi-use, lightweight pipe. While all this might lead you to think that you're getting a truly retro, heavy-duty pipe kit made of black plumbing pipe, you are not. But, does it matter? Depends. I find the lighter pipe's smooth finish a nice "tone-down" from the rough plumbing look. All together, this kit provides plenty of strength for most furniture and the rustic pipe look, but with a nicer, lighter finish. To me that is a plus--this is a very nice kit and costs less that if you'd pieced it together from real plumbing parts (I priced it out to compare), and looks retro but cleaner. I knew what to expect because while I got this kit free on Vine, I had purchased a nearly identical kit from another seller last year. So, I'm giving it 5 stars for what it actually is and for the price, JUST BE AWARE THE NARRATIVE IS MISLEADING. Which is unfortunate because just like some people might want the heavier pipe, I'm betting more would be attracted to the look with a cleaner, lighter feel.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 31, 2025
R
Verified Purchase
R
Cuba, US
★★★★★ 5
Strong legs, somewhat industrial but trendy also
Size: side table leg
Good legs, some what utilitarian or industrial, they are strong as they are made out of pipe, and assembly is fairly easy once you get the idea of how it goes together. They are roughly 1.5 feet across maybe a bit less adjustable height on each leg, if you have wood floors you may want to put a pad under each leg as they are full metal pipes. Pretty interesting idea and does not cost much.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
N
Verified Purchase
Nc
Lowell, US
★★★★★ 4
Pretty good, take your time and install it well
Size: side table leg
Materials are pretty solid, but once assembled it’s not as sturdy as you would think it should be since the material itself was solid, i say give them a chance, everything out there that’s similar is way over priced
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
R
Verified Purchase
Roberta Mayes
Carnegie, US
★★★★★ 5
Heavy duty legs for table.
Size: side table leg
Perfect legs for a table I am having made. I have an cottonwood slice. It's heavy and needed something substantial. These are perfect.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 25, 2026
R
R. Moheban
San Leandro, US
★★★★★ 5
Robust pipe & fittings with a beautiful, smooth black finish
Size: side table leg
This set of pipe & fittings for use as low table legs is heavy duty and aesthetically pleasing. Especially when the pieces are handled, the tactile sensation is much nicer than with plumbing steel pipe because this product is beautifully finished smooth. The black pipes are quite smooth as well as the fittings. The pieces are all also pretty robust, though the wall thicknesses are less than in pipe for pressurized water systems. Of course that makes sense as this product does not need to hold fluid pressure. In my view they got the heaviness factor of this product just right; it's not as heavy or robust as black pipe used in natural gas supplies, but still robust and pretty heavy. Assembled, this product is absolutely stiff and unyielding for a solid table that could hold a man's weight easily. The feet utilize a brilliant scheme so that each foot can be independently adjusted for an uneven floor. Thus a level table on an uneven floor is easily accomplished. The feet simply extend the effective leg length by screwing counter-clockwise. To prevent any shifting at the threads adding some pipe compound or teflon tape may be advised. Even masking or duct tape might work as the idea is to just fill any gaps where male threads meet female threads. The four flanges at the tops of the legs provide a wide, solid surface for attaching the table top, with either hidden screws underneath or you could through-bolt a glass table top (provided you have the skill to drill glass!). I think this product would look great with a glass top. Assembly is quick and easy. The hardest part is drilling holes underneath the table top to accept screws. No pipe wrenches are needed as the pieces screw together by hand to an adequate tightness. If any doubt whether they are tightened enough have a strong person with grippy gloves finish. The "X" in the center attaches to the legs with a very clever machine screw system tightened with the included hex wrench. This is presumably because if tightened simply by screwing the fittings, the point of snugness would not likely be where the "T" fittings are exactly vertical. The maker has solved this problem so that you are assured that all legs will be in the perfect vertical position once everything is tight. The setup is also nice and rigid once tightened. This is a huge benefit of steel pipe projects; they are really solid. The black finish is clearly very durable, like a powder coat. It appears that it will provide excellent protection against rust. Coverage is complete; I found no dings or scratches anywhere on any piece. Overall this is a very well-designed product for function and aesthetics. Perfect for a beautifully renovated warehouse condo where an industrial vibe is desired in a rock-solid table that won't shift around. The smoothness of the pipe is top notch. I've used lots of pipe in projects, some of it actual water pipe and some decorative pipe such as this. I've never seen better quality decorative pipe as this maker put in the effort to finish it beautifully smooth. At currently $34.99 I find the price quite reasonable too.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 18, 2026

recommand products