SKU: 8251462968

IgG2a Fc (Glu98-Lys330) Protein, Mouse

Sale price$127.80 Regular price$142.00
Save 10%

Pay in installments of $35.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IgG2a Fc (Glu98-Lys330) Protein, MouseProduct Specification Species Mouse Synonyms IgG2A Accession P01863 Amino Acid Sequence Glu98 Lys330 EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK Expression System HEK293 Molecular Weight 29 33kDa (Reducing) Purity 95% by SDS PAGE Endotoxin <0. 1EU g Conjugation

Product Specification


Species Mouse
Synonyms IgG2A
Accession P01863
Amino Acid Sequence

Glu98-Lys330 EPRGPTIKPCPPCKCPAPNLLGGPSVFIFPPKIKDVLMISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQDWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTDFMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEGLHNHHTTKSFSRTPGK

Expression System HEK293
Molecular Weight 29-33kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag No Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4.
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Hock, Goddard, MacPherson et al.Levels and in vitro functional effects of circulating anti-hinge antibodies in melanoma patients receiving the immune checkpoint inhibitor pembrolizumab. PLoS One (2023) 18 (9), e0290793.

Background

Immunoglobulin G2 (IgG2) is a member of many immunoglobulin G developed and secreted by effective B cells. In wake of cutting by pepsin, IgG is divided into two F(ab)s with one antigen binding site and a high conserved Fc segment. The Fc segment bears a highly conserved N-glycosylation site. Some studies have shown that mIgG2a has a greater effect compared with mIgG1 and mIgE in controlling tumor growth in a therapeutic setting.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 8251462968

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 28 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Grantham, US
★★★★★ 5
Perfect Mattress Pad
Size: Full, Color: White
Light and fluffy with no noise of a waterproof layer. Excellent mattress pad. Thank you.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 20, 2026
P
Verified Purchase
Pyr Lover
Bozeman, US
★★★★★ 5
Beat Mattress Protector yet!
Size: Queen, Color: White
This is the ULTIMATE bed protector I’ve bought in MANY years! Fits SUPER deep mattress. Has a nice thick fill. Doesn’t have any crinkle sound when you move nor makes you feel “hot” either. Literally waterproof also definitely works at keeping mattress protected especially against a huge amount of water poured on top! Washes and dries well in the dryer without shrinkage or losing any lot or waterproofing. Don’t use any bleach or softener or dryer sheets. Fantastic but and HIGHLY recommend! Doesn’t shift on bed either. Has full elastic type mesh ALL around the side of mattress that goes underneath to hold firmly in place. Order size of actual bed even if you have extended height mattress.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 5, 2025
P
Verified Purchase
Paige C.
Natrona Heights, US
★★★★★ 5
Great fit, good added comfort, long dry time
Size: Twin, Color: White, Size: Twin, Color: White
I got the regular twin size for my toddler’s bed. Before, he had a yellow foam topper (one of the cheap ones) and a mattress protector that barely stretched to the bottom of the mattress. I LOVE that this is such a deep fit so I didn’t need to worry about it coming up a lot. We have a standard size twin mattress. For breathability, it does seem like it might trap heat- it is very warm to lay on the mattress now, but that doesn’t bother us. It is comfortable to lay on the mattress. I don’t think it is as thick as the foam topper we had, but that was expected. For a waterproof topper, it’s a pretty good fluffiness. Washing: Hours fit in our washing machine fine. However, I did have to dry it three times. You can’t dry it with anything else or whatever else is in there gets bundled up inside it. I didn’t take a star off for this because we generally have to run loads a second time in our dryer anyways, and it might be because of the weight that it takes longer to dry. overall, I am happy with the purchase! My toddler’s bed is much more “in place” with the sheets, it’s still comfortable and the cost is worth the money to me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 13, 2024
I
I heard it on the grape v
Charlottesville, US
★★★★★ 5
Get your comfy on
Color: Black, Size: King, Color: Black, Size: King
This Bedsure King Mattress Topper - Viscose Made from Bamboo: This ultra-soft, thick, and fluffy pillow top mattress pad is made from bamboo and is 21 inches deep with a breathable, moisture-wicking design. It’s available in black and measures 78x80 inches. While it’s a great choice, it does take a bit of time to be able to use when you first receive it. First, you need to remove the packaging and then put it in the dryer on low fluff for 20 minutes. After that, you should lay it across your bed for 24 hours to allow it to expand fully. So, plan on not being able to use it for 2 days. However, following these instructions will ensure that you get the best ultra-soft thickness and the perfect fit for your bed, plus you’ll feel comfortable when you’re ready to sleep on it. This Bedsure King Mattress Topper is incredibly comfortable. You’ll have the best nights’ sleep of your life with it. The quality of this topper is exceptional. I washed it, dried it, and it still came out perfect. There were no clumps or bunching. It laid out perfectly on our king bed mattress. This thing feels amazing. I didn’t want to get out of bed. Being a coffee addict, I didn’t mind not having it first thing in the morning because it’s so soft. My husband even approved of this topper. I like how both of lying on it, I don’t feel him moving around. This Bedsure King Mattress Topper is not too soft that you sink in. It’s just right. It’s like a soft hug on your body, but not wrapped around you. After a few days of sleep on it, my back didn’t hurt. I was surprised. I also like how this topper helps protect and keep your mattress from wearing out quickly. It provides long-lasting stability to your mattress. This Bedsure King Mattress Topper is the perfect thickness. I love how my sheets still fit over this and my mattress with no problems. The topper stays put on my mattress also. I like the added elastic band for support keeping it in mattress. We just bought a new mattress and I wanted a topper to add more comfort so this was a perfect addition. Ive bought other Bedsure items for our condo, we rent out and guests always like those toppers. This the first time getting a single topper with no memory foam added separately. I have to say I like the added comfort this Bedsure King Mattress Topper - Viscose Made from Bamboo Ultra Soft Thick Fluffy Pillow Top Mattress Pad with 21 Inch Deep Pocket, Breathable, Moisture Wicking, Black, 78x80 Inch adds to our mattress top. It’s just the right added comfort. You can’t see the wording Bedsure through sheets either. I get do my stretches in bed, yoga and still able to do with no problems. The price is spot on for a nice quality mattress pad. Definitely highly recommend getting this for your mattress. You will be glad you did. It will last a long time.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
J
JANELV
New York, US
★★★★★ 5
A better topper from a company I trust
Color: Black, Size: Twin
I have a memory foam daybed that has seen better days. The top layer has started to shift from regular use, and I wanted something that would help hold it together. The Bedsure Twin Mattress Topper does exactly that and made a huge difference right away. This is a high quality, well constructed mattress pad. It fits securely over an extra thick mattress and stays in place. The corner bands under deep pockets are strong and keep everything aligned without slipping. The measurements are accurate. There are instructions to dry it, then leave it out to expand. There was no weird smell. What you see is exactly what you get, in a good way. The cushioning is even and comfortable, and the fabric feels thick and smooth. It adds structure while still improving comfort. It has a more premium look and function than expected, similar to what you would find in a Five-Star hotel. It feels expensive. I also appreciate that the color is not white. It looks cleaner over time and feels like a more practical choice. I have used several Bedsure products, and the quality has been consistent. I also like that it is a woman founded and owned brand, and they continue to improve their products.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026

recommand products