SKU: 82599083930

Human NKX2.2, His tag

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human NKX2.2, His tagProduct Specification Species Human Synonyms Homeobox protein NK 2 homolog B, NKX2. 2, NKX2B Accession O95096 Amino Acid Sequence Protein sequence (O95096, Met1 Lys127, with C 10*His) MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKGGGGSHHHHHHHHHH Expression System HEK293 Molecular Weight Predicted MW: 14. 9 kDa Observed MW: 20 33 kDa Purity 95% by SDS PAGE Tag with C

Product Specification


Species Human
Synonyms Homeobox protein NK-2 homolog B, NKX2.2, NKX2B
Accession O95096
Amino Acid Sequence

Protein sequence (O95096, Met1-Lys127, with C-10*His) MSLTNTKTGFSVKDILDLPDTNDEEGSVAEGPEEENEGPEPAKRAGPLGQGALDAVQSLPLKNPFYDSSDNPYTRWLASTEGLQYSLHGLAAGAPPQDSSSKSPEPSADESPDNDKETPGGGGDAGKGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 14.9 kDa Observed MW: 20-33 kDa
Purity >95% by SDS-PAGE
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Homeobox protein Nkx-2.2 is a protein that in humans is encoded by the NKX2-2 gene. Homeobox protein Nkx-2.2 contains a homeobox domain and may be involved in the morphogenesis of the central nervous system. This gene is found on chromosome 20 near NKX2-4, and these two genes appear to be duplicated on chromosome 14 in the form of TITF1 and NKX2-8. The encoded protein is likely to be a nuclear transcription factor. The expression of Nkx2-2 is regulated by an antisense RNA called Nkx2-2as. In the developing spinal cord, Nkx-2.2 regulates IRX3 thereby contributing to the proper differentiation of the ventral horn neurons.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 82599083930

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.0 ★★★★★
Based on 7 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Chad I
Fort Morgan, US
★★★★★ 5
Good quality!
Size: 9.3" x 9.7" x 1.8"
This cabin air filter is seriously a game-changer for my car's interior air quality. I was getting tired of that stale, dusty smell every time I turned on the AC. Swapping it out was surprisingly easy, and the difference was noticeable almost immediately. It really does trap all those tiny particles, like pollen and dust, that used to make my allergies flare up. Now, the air inside my vehicle feels so much fresher and cleaner. I've been recommending this brand to all my friends who are looking for a reliable filter. It's definitely worth the investment for a more comfortable driving experience. Seriously, if you're on the fence, just go for it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
B
Verified Purchase
Bartek
San Leandro, US
★★★★★ 5
Noticeable upgrade in air quality and a seamless installation
Size: 9.3" x 9.7" x 1.8"
I'm generally skeptical of the "HEPA" marketing for automotive filters, but after installing this in my Honda, the reduction in exterior odors—especially exhaust and pollen—is actually significant. The construction feels far more robust than the flimsy OEM paper filters I’ve used in the past; the pleats are dense and well-reinforced, which gives me more confidence in its filtration efficacy over a 12,000-mile interval. Installation was straightforward and took less than five minutes. It’s a precision fit with no gaps around the edges, ensuring that all intake air is actually being routed through the media rather than bypassing it. One thing to note is that you might notice a very slight decrease in max fan velocity due to the increased density of the HEPA material, but the tradeoff for cleaner air is well worth it in my opinion. If you live in an area with high pollution or suffer from seasonal allergies, this is a legitimate quality-of-life improvement for your daily commute.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 26, 2026
M
Verified Purchase
Michael
Boise, US
★★★★★ 5
Exact fit!
Size: 9.3" x 9.7" x 1.8"
Was a great replacement for OE on my 2012 Honda Accord. It was the exact same size as the previous filter and has no strange smells or odors. Very easy to install behind the glove box and looks great!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 23, 2026
D
Verified Purchase
David M
Chelsea, US
★★★★★ 4
Bosch quality
Size: 9.3" x 9.7" x 1.8"
Fit my vehicle without any problems. Quality similar to the OEM filter and at a much better price.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 25, 2026
S
Verified Purchase
SS
Chelsea, US
★★★★★ 5
Great Filter, Good Quality!
Size: 9.3" x 9.7" x 1.8"
The beauty of this filter is that it comes with very clear instructions on what to do. Not a lot of manufacturers. Give clear instructions. I got this for a 2007 MDX. The packaging of the product itself was well done by Bosch. Installation was a breeze and as soon as I turned on the air conditioning post installation, I could tell the very clear difference. Plus, I also got an opportunity to look at the old filter which was filled with the usual culprits and debris. The initial airflow did have a mild smell of kerosene or like fuel. But this could also be because of the filter component itself needing to be vented out. I would recommend keeping the filter out for about 30 to 60 minutes before installation. Once installed, however, the improvement in air quality was very evident. The fit was very good as well. Highly recommend this. Very high quality.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 18, 2025

recommand products