SKU: 85490424923

Human TIMP2 Protein, His Tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 14 - Aug 19

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human TIMP2 Protein, His TagProduct Specification Species Human Synonyms Metalloproteinase inhibitor 2, CSC 21K, Tissue inhibitor of metalloproteinases 2 (TIMP 2) Accession P16035 Amino Acid Sequence Protein sequence (P16035, Cys27 Pro220, with C His Tag) CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP Expression System HEK293

Product Specification


Species Human
Synonyms Metalloproteinase inhibitor 2, CSC-21K, Tissue inhibitor of metalloproteinases 2 (TIMP-2)
Accession P16035
Amino Acid Sequence

Protein sequence (P16035, Cys27-Pro220, with C-His Tag) CSCSPVHPQQAFCNADVVIRAKAVSEKEVDSGNDIYGNPIKRIQYEIKQIKMFKGPEKDIEFIYTAPSSAVCGVSLDVGGKKEYLIAGKAEGDGKMHITLCDFIVPWDTLSTTQKKSLNHRYQMGCECKITRCPMIPCYISSPDECLWMDWVTEKNINGHQAKFFACIKRSDGSCAWYRGAAPPKQEFLDIEDP

Expression System HEK293
Molecular Weight Predicted MW: 23.4 kDa Observed MW: 20-25 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TIMP2 (Tissue Inhibitor of Metalloproteinases 2) is a key regulatory protein belonging to the TIMP family, which inhibits matrix metalloproteinases (MMPs) to maintain extracellular matrix (ECM) homeostasis. By controlling MMP activity, TIMP2 plays a critical role in tissue remodeling, wound healing, and inflammation. Beyond its inhibitory function, TIMP2 exhibits MMP-independent activities, such as modulating cell growth, differentiation, and angiogenesis. It is also involved in pathological processes, including cancer progression and fibrosis, where its dysregulation contributes to ECM degradation or excessive deposition.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 85490424923

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 18 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Customer Jessica
Dallas, US
★★★★★ 5
So Beneficial!
Color: Silver
I bought the HERRBOL 3-in-1 Charging Station for my husband and honestly, it ended up being one of those purchases that made my life easier too! From a wife’s perspective, anything that reduces clutter and keeps things organized is a huge win—and this charger does exactly that. Before this, we had cables everywhere—on the nightstand, tangled behind the bed, constantly getting misplaced. Now, his phone, watch, and AirPods all have one neat, dedicated spot. It instantly made our space look cleaner and more put-together, which I absolutely love. What really impressed me is how simple it is to use. He just drops everything onto the stand and it charges—no fuss, no plugging and unplugging. The magnetic alignment for the phone is strong and satisfying, and I never have to hear “Have you seen my charger?” anymore (which might be my favorite feature, honestly!). It’s also very sleek and modern-looking, so it doesn’t feel like an eyesore sitting on our nightstand. It blends in nicely with our decor, which is something I always pay attention to. Overall, this was such a practical purchase that benefits both of us. If you’re a wife tired of messy cords and disorganized tech clutter, I highly recommend this charging station—it’s one of those small upgrades that makes daily life feel just a little bit smoother.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 22, 2026
S
Verified Purchase
Shelley C.
Lake Worth, US
★★★★★ 5
Charge everything in one place
Color: Silver
These are great. I have purchased 3 and have them at work and home. My spouse has one and her uncle just purchased one. Great to have everything charging in one place.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
S
Verified Purchase
SciFiJunkie
Cuba, US
★★★★★ 5
MagSafe Charger
Color: Silver
Works great, doesn’t take up a lot of space. Very pleased with the setup.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 19, 2026
K
Verified Purchase
Kindle Customer
Chelsea, US
★★★★★ 3
Came broken
Color: Silver
Came broken box was all busted up had to glue it but it works fine. Update lasted less than 1 year. No longer works
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 30, 2025
J
Verified Purchase
Judy Compton
Phoenix, US
★★★★★ 5
Charging station for your phone/Apple Watch
Color: Silver
Great size Durability easy to use Worth the money, great all around!!!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026

recommand products