Pay in installments of $17.50 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 16 - Aug 21
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Mouse Complement C3a Protein, His TagProduct Specification Species Mouse Synonyms HSE MSF, Complement C3 alpha chain, Accession P01027 Amino Acid Sequence Protein sequence (P01027, Ser671 Arg748, with N His Tag) SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR Expression System HEK293 Molecular Weight Predicted MW: 10. 9 kDa Observed MW: 10. 9 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag with N His tag Physical Appearance
Product Specification
| Species | Mouse |
| Synonyms | HSE-MSF, Complement C3 alpha chain, |
| Accession | P01027 |
| Amino Acid Sequence | Protein sequence (P01027, Ser671-Arg748, with N-His Tag) SVQLMERRMDKAGQYTDKGLRKCCEDGMRDIPMRYSCQRRARLITQGENCIKAFIDCCNHITKLREQHRRDHVLGLAR |
| Expression System | HEK293 |
| Molecular Weight | Predicted MW: 10.9 kDa Observed MW: 10.9 kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | with N-His tag |
| Physical Appearance | Lyophilized powder |
| Storage Buffer | Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose. |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage | 12 months from date of receipt, -20 to -70 °C as supplied. |
Background
Complement C3a is a small bioactive peptide (77 amino acids) derived from the cleavage of complement component C3, a central protein in the complement system—a key part of innate immunity. C3a acts as an anaphylatoxin, binding to the C3a receptor (C3aR) on immune cells (e.g., mast cells, macrophages), triggering inflammation, chemotaxis, and cytokine release. It enhances immune responses against pathogens but can also contribute to inflammatory diseases (e.g., sepsis, asthma) if dysregulated. C3a also modulates tissue repair and metabolic processes, highlighting its dual role in immunity and homeostasis. Its functions are tightly regulated by the carboxypeptidase-mediated inactivation to C3a-desArg.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy