Pay in installments of $46.88 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 17 - Aug 22
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
Human h-FABP3, His TagProduct Specification Species Human Synonyms Fatty acid binding protein 3, Heart type fatty acid binding protein (H FABP), Mammary derived growth inhibitor (MDGI), Muscle fatty acid binding protein (M FABP) Accession P05413 Amino Acid Sequence Protein sequence(P05413, Met1 Ala133 with C 10*His) MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDILTLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDGQETTLVRELIDGKLILTLTHGTAVCTRTYEKEAGGGGSHHHHHHHHHH Expression
Product Specification
| Species | Human |
| Synonyms | Fatty acid-binding protein 3, Heart-type fatty acid-binding protein (H-FABP), Mammary-derived growth inhibitor (MDGI), Muscle fatty acid-binding protein (M-FABP) |
| Accession | P05413 |
| Amino Acid Sequence |
Protein sequence(P05413, Met1-Ala133 with C-10*His)
|
| Expression System | E.coli |
| Molecular Weight | Theoretical: 16.5kDa Actual: 18kDa |
| Purity | ＞95% by SDS-PAGE |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Reconstitution | Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation. |
| Stability & Storage |
12 months from date of receipt, -20 ℃ to -70 °C as supplied. 1 month, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles. |
Background
Heart-type fatty acid binding protein (hFABP) also known as mammary-derived growth inhibitor is a protein that in humans is encoded by the FABP3 gene. Heart-type Fatty Acid-Binding Protein (H-FABP) is a small cytoplasmic protein (15 kDa) released from cardiac myocytes following an ischemic episode. H-FABP is a sensitive biomarker for myocardial infarction and can be detected in the blood within one to three hours of the pain. In addition to its diagnostic potential, H-FABP also has prognostic value. Alongside D-dimer, NT-proBNP and peak troponin T, it was the only cardiac biomarker that proved to be a statistically significant predictor of death or MI at one year. This prognostic information was independent of troponin T, ECG and clinical examination.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy