SKU: 90649562857

IFN-γ His Tag Protein, Human

Sale price$121.50 Regular price$135.00
Save 10%

Pay in installments of $33.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IFN-γ His Tag Protein, HumanProduct Specification Synonyms IFN ,Immune Interferon,type II interferon,T cell interferon,MAF,IFNG,IFG,IFI,IFN gamma Accession P01579 Amino Acid Sequence QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH. Expression System HEK293 Molecular Weight 18. 5 kDa (Reducing) Purity >95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag

Product Specification


Synonyms IFN-γ,Immune Interferon,type II interferon,T cell interferon,MAF,IFNG,IFG,IFI,IFN-gamma
Accession P01579
Amino Acid Sequence

QDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLFKNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVMAELSPAAKTGKRKRSQMLFRGRRASQGGGGSHHHHHHHHHH.

Expression System HEK293
Molecular Weight 18.5 kDa (Reducing)
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized powder
Storage Buffer

0.2M PBS, pH7.4.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage
12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

IFN-gamma, the only member of type II interferon, is a soluble dimer cytokine secreted mainly by natural killer cells (NK) and natural killer T cells (NKT) when it functions in innate immunity. During antigen-specific immunity it is secreted by CD4 Th1 and CD8 cytotoxic T cells.IFN-gamma acts on the whole process of tumorigenesis and development, and its anti-tumor mechanism is mainly divided into immune mechanism and non-immune mechanism.IFN-gamma can directly inhibit tumor cell proliferation, promote tumor cell apoptosis, inhibit tumor angiogenesis, and cooperate with NK, NKT, γδT cells and CD4+/CD8+T cells of innate and adaptive immunity to complete tumor killing. In addition, IFN-gamma also has an important immunomodulatory function, which can improve the lysosomal activity of macrophages, and has an anti-proliferation effect on transformed cells.This product is the recombinant human Renin protein expressed from human 293 cells (HEK293).

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 90649562857

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 29 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kaylee M.
Omaha, US
★★★★★ 5
Such a well developed story.
Format: Kindle
I LOVE this book. She does such a good job of researching that you never question if she knows anything about search and rescue dogs. The characters were amazing(as usual). She rapped it up nicely BUT I’m really really hoping she makes a sequel. There’s just so much more I want to know/see happen with these characters after this.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 29, 2021
R
Reviewer Mac
Whiting, US
★★★★★ 4
A heartfelt exploration of family in all of its forms
Format: Hardcover
This novel follows a young woman named Kira Bennett, who was found by Cady Bennett and her search and rescue dogs out in the woods. Apparently, Kira had been living alone and wild in the woods but for how long and why, nobody knows. Kira remembers bits and pieces of her life in the forest but has no memories of before that time. Kira is adopted by the Bennett family and learns the family business: Search-and-Rescue. Working alongside Cady, Cady's son Jude and their neighbor Free, Kira trains search-and-rescue dogs and she hopes to perform rescues herself eventually. It's worth mentioning that Kira has a difficult time connecting with people, does not like making eye contact or being touched and her "wild" side often overtakes her. She's definitely more comfortable with dogs than with people. Soon, Kira and the others kids find themselves involved in a real live search and rescue when Cady's estranged father finds her and asks for her help in locating a little girl who disappeared in Sierra Glades National Park. Kira soon becomes obsessed with the case, having been in the same situation herself — being lost in the wild, alone. As they search for the girl, several strange events occur leading everyone to discover that there is a lot more to this case than a straightforward child lost in the woods and danger soon mounts for those involved. Moreover, the case has triggered old memories for Kira — chilling memories — which begin to overwhelm her. Then, secrets about Kira's true nature, the Bennett family and about what happened to her come to light causing her to confront some painful truths. What I found especially fun about this story were the layers upon layers of mysteries that the story presented: there's the mystery of Kira's past and her real family; the mystery of who Jude's real father is; the mystery of the animosity between Cady and her father; the mystery of Gabriel, the strange boy living with Cady's father; and of course, the mystery of the lost girl. Just about everyone is hiding something. Though there's a lot going on here, the plot is well-thought out, easy to follow and downright compelling as it's a suspenseful story with plenty of twisty surprises. I also loved the inclusion of the dogs in this story and how integral they were to the plot line. The strong bond between the teens and their canines was heartwarming. I enjoyed learning about rescue dogs and their training and thought that this added a rich element to the story. But mostly, this book was a heartfelt exploration of family in all of its forms, whether it be human or canine and teaches that a family created out of love can often be just as strong as a family formed by blood. All in all, I thought the Lovely and the Lost was wildly entertaining with relentless pacing, richly developed and empathetic characters, and a satisfying conclusion rendered this an undeniable page-turner. Many thanks to NetGalley and the publisher Freeform for the advanced reader copy in return for an honest review!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2019
A
Verified Purchase
ABnyc
Pawtucket, US
★★★★★ 5
Clear and Accessible
Format: Paperback
Great resource. I find these explanations accessible and the strategies scaffolded thoughtfully. No typos in my edition. Makes it easy to test prep while tutoring or in the classroom.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 15, 2025
J
Verified Purchase
Jordy Portugal
Boise, US
★★★★★ 5
Essential Prep for Top Scorers
Format: Paperback
As someone who was initially apprehensive about the transition from the traditional SAT to the new Digital SAT (DSAT), this test prep book has been a game changer. What sets this book apart is its targeted approach. It's designed for students already scoring 600 or higher, focusing on the challenging questions of Module 2. This precision in practice ensures that you're not just reviewing what you already know - you're pushing the boundaries of your testing ability. Each question is expertly crafted to mirror the format and difficulty of the actual DSAT questions, which has helped me gain confidence in handling the trickier problems, especially in the adaptive sections. The explanations are thorough and insightful, providing deeper understanding and techniques that are crucial for the exam. Thanks to this book, I feel significantly more prepared than I ever have before. For anyone serious about aiming for the 99th percentile - this test prep book is for you!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 8, 2024
P
Verified Purchase
Peter Kwon
Phoenix, US
★★★★★ 5
Perfect for Serious Students!
Format: Paperback
As it states in the product details, the DSAT Prep book is great for students who already score 600 and higher. As a teacher and tutor of the SATs (among other standardized exams), I needed more practice sets outside of the Barron's, The Princeton Review, and The College Board publications, which tend to be more mindful of beginner learners. I wasn't confident that the modules and questions from these texts were sufficiently challenging strong students. The DSAT from Edenbrook Learning removed that doubt. I also appreciate the simplicity of the layout of the text: literally 4 tests with respective answer keys, raw score conversion, and explanations. There's no fluff — perfect for my needs. Will recommend to colleagues and students alike!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2024

recommand products