SKU: 92188117322

AGER His Tag Protein, Human

Sale price$252.00 Regular price$280.00
Save 10%

Pay in installments of $70.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

AGER His Tag Protein, HumanProduct Specification Species Human Synonyms RAGE, Receptor for advanced glycosylation end products Accession Q15109 Amino Acid Sequence Ala23 Ala344, with C terminal 8*His

Product Specification


Species Human
Synonyms RAGE, Receptor for advanced glycosylation end products
Accession Q15109
Amino Acid Sequence

Ala23-Ala344, with C-terminal 8*His AQNITARIGEPLVLKCKGAPKKPPQRLEWKLNTGRTEAWKVLSPQGGGPWDSVARVLPNGSLFLPAVGIQDEGIFRCQAMNRNGKETKSNYRVRVYQIPGKPEIVDSASELTAGVPNKVGTCVSEGSYPAGTLSWHLDGKPLVPNEKGVSVKEQTRRHPETGLFTLQSELMVTPARGGDPRPTFSCSFSPGLPRHRALRTAPIQPRVWEPVPLEEVQLVVEPEGGAVAPGGTVTLTCEVPAQPSPQIHWMKDGVPLPLPPSPVLILPEIGPQDQGTYSCVATHSSHGPQESRAVSISIIEPGEEGPTAGSVGGSGLGTLALAGGGSHHHHHHHH

Expression System HEK293
Molecular Weight 47-54kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1.Vissing H., Aagaard L., Tommerup N., Boel E. Localization of the human gene for advanced glycosylation end product-specific receptor (AGER) to chromosome 6p21.3. Genomics. 1994;24(3):606–608.
2.Yan S. D., Chen X., Fu J., et al. RAGE and amyloid-β peptide neurotoxicity in Alzheimer’s disease. Nature. 1996;382(6593):685–691.
3.Deane R., du Yan S., Submamaryan R. K., et al. RAGE mediates amyloid-β peptide transport across the blood-brain barrier and accumulation in brain. Nature Medicine. 2003;9(7):907–913.
4.Krechler T., Jáchymová M., Mestek O., Žák A., Zima T., Kalousová M. Soluble receptor for advanced glycation end-products (sRAGE) and polymorphisms of RAGE and glyoxalase I genes in patients with pancreas cancer. Clinical Biochemistry. 2010;43(10-11):882–886. 2010.04.004.

Background

AGER (advanced glycation end-product-specific receptor encodes a cell surface receptor for advanced glycation end-products (RAGE). This gene is located on the short arm of chromosome 6: 6p21.3. This locus is involved in inflammatory and immune responses and is also the locus of major histocompatibility complex III. Recently, sRAGE was demonstrated as a new biomarker for lung cancer and RAGE could be a potential therapeutic target in Alzheimer's disease. The genetic background of RAGE demonstrated that some gene polymorphisms are implicated in various pathological states, for example, diabetes complications, amplification of the inflammatory response, non-small cell lung cancer, gastric cancer, or breast cancer.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 92188117322

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.8 ★★★★★
Based on 17 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Amazon Customer
Cuba, US
★★★★★ 5
Extremely comfortable, leather sole. Hard to find a style.
Size: 13.5-14.5 Women/12-13 Men, Color: Navy Blue, Size: 13.5-14.5 Women/12-13 Men, Color: Navy Blue
Totally worth the price. This type of style is very hard to find, my husband had another pair a few years ago that he was never able to replace. These fit his wide feet and are very comfortable. The elastic at the ankle is not too tight. So glad I was able to find him a replacement. We bought the blue in a size 12. Love the fact that they are washable.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 12, 2026
M
Verified Purchase
Michael Arnhold
Battle Creek, US
★★★★★ 5
Very comfortable Slippers. Great buy!
Size: 12-13 Women/10.5-11.5 Men, Color: Charcoal
I bought these to replace a pair of slippers that I have had for years that are very similar to the slippers I bought, but I had worn a hole in the leather on mine, so I had to find something new and similar. These slippers are worth the money they are very comfortable, and I am sure they will last for years. They are a little tight around the ankle cuff but they are still new and I am sure they will wear in a little more when I start wearing them more.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 8, 2025
J
Verified Purchase
Jenn
Carnegie, US
★★★★★ 3
Great slippers but disappointing quality.
Size: 7.5-8.5 Women/6-7 Men, Color: Ash, Size: 7.5-8.5 Women/6-7 Men, Color: Ash
Extremely comfortable, attractive slippers but the stitching came loose on both leather trim areas almost immediately. I tried to sew/glue down the stitching (as seen in photo) but it kept unraveling. Disappointing as these slippers are great in every other way (though they do run a bit big...I wear a 9 but ended up with a 7.5-8.5 which fits with a bit of room to spare even with thick socks). I just hope they hold up after my latest attempt to stop the thread from pulling out any more as I do really love wearing them. Perhaps I just got a bum pair?
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 3, 2024
M
Verified Purchase
Masselyn
Lake Worth, US
★★★★★ 5
Tight at first, but they stretch after a short time...feel perfect after the first week!
Size: 9.5-10.5, Color: Charcoal Faux Fur
I love them! My first impression was "oooh, this is too tight". I wear a size 10 shoe and honestly, the 9.5-10.5 felt tight when I first tried it. Without socks it felt okay, with socks my toes were right at the top. But I loved the style so much I decided to give it a chance - I am SO glad I did!!! They do stretch and give, so don't expect it to be tight forever. I have had them a week or so, wearing each day (I WFH) and they feel really nice. I also live in the mountains, we just had our first winter storm, and these slippers are nice and toasty. Exactly what I needed. The memory foam is plush, though I have had other slippers with it and I know it will squash down over time. Right now, it is a nice feeling as I walk around the house. They are super cute looking, wearing leggings allows me to feel like I am stylish even while still wearing my sleep thermals. YAY!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 18, 2025
A
Verified Purchase
Alyene
New York, US
★★★★★ 5
favorite slipper ever
Size: 8-9, Color: Charcoal Faux Fur
I love these slippers. They look great with pants tucked in. Incredibly warm and comfortable. I wear them almost every day. Fit is true to size. They stay up but are not tight at all. On top of that I get compliments on them. Highly recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 3, 2026

recommand products