SKU: 92221628047

Human IL-12A, His tag

Sale price$166.50 Regular price$185.00
Save 10%

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 15 - Aug 20

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-12A, His tagProduct Specification Species Human Synonyms Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL 12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1 Accession P29459 Amino Acid Sequence Protein sequence (P29459, Arg23 Ser219, with C 10*His)

Product Specification


Species Human
Synonyms Cytotoxic lymphocyte maturation factor 35 kDa subunit (CLMF p35), IL-12 subunit p35, NK cell stimulatory factor chain 1 (NKSF1), NKSF1
Accession P29459
Amino Acid Sequence

Protein sequence (P29459, Arg23-Ser219, with C-10*His) RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNASGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight Predicted MW: 24.2 kDa Observed MW: 35-45 kDa
Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Tag with C-10*His
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Interleukin-12 subunit alpha (IL-12 p35) is a protein that in humans is encoded by the IL12A gene. This gene encodes a subunit of the cytokine Interleukin 12 (IL-12) that acts on T and natural killer cells, and has a broad array of biological activities. The cytokine is a disulfide-linked heterodimer composed of the 35-kD subunit encoded by this gene, and a 40-kD subunit that is a member of the cytokine receptor family. This cytokine is required for the T-cell-dependent induction of interferon gamma (IFN-γ), and is important for the differentiation of both Th1 and Th2 cells. The responses of lymphocytes to this cytokine are mediated by the activator of transcription protein STAT4. Nitric oxide synthase 2A (NOS2A/NOS2) is found to be required for the signaling process of this cytokine in innate immunity.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 92221628047

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.5 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
KR
Louisville, US
★★★★★ 5
Virtually indestructible
Size: 8 Inch, Color: Red
Long lasting ball for a large dog. Bought the first one a few years ago. Its been outside all this time, still full of air and was virtually impossible for my large dog to destroy it. The weather affected the surface so ordered a new one. This has outlasted all the other balls.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 14, 2026
B
Verified Purchase
bbiearman
Birmingham, US
★★★★★ 4
Great toy for larger dogs
Size: 8 Inch, Color: Pink
This is holding up pretty well with my Great Pyrenees pup. She was able to pull all of the tags off-but the ball is intact for several weeks!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 24, 2025
C
Verified Purchase
Cmarr
Charlottesville, US
★★★★★ 5
QDAN has great durable dog toys
Size: 8 Inch, Color: Yellow
It’s very durable ball lots of fun for dogs
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 24, 2026
B
Verified Purchase
Brown
Alexandria, US
★★★★★ 5
So much fun
Size: 8 Inch, Color: Pink
Best money ever spent hours of fun. We have 3 dogs. They all love to play with this toy. We got the size 3 large is what we ordered. I'm not going to lie I thought it would be bigger when I ordered it. Two of our dogs are large breeds and the other is medium. It's not too big for the medium to play with it. It comes with a ball pump included so convenient. The little tabs are very durable. I can't recommend this enough. This has no squeaking or any sounds. It's nice that you can play with your four legged companion or you can have them play tug or just enjoy pushing the ball around. It is very versatile in play and stimulation.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 8, 2025
A
Verified Purchase
allyson handabaka
Lake Worth, US
★★★★★ 3
Not for chewers
Size: 8 Inch, Color: Yellow, Size: 8 Inch, Color: Yellow
My dog managed to pop this and completely chew through it in a matter of 4 days. It was definitely cute and she loved the size of it but with her chewing all the way to the core we have to get rid of it. I thought it was a good material but I guess I was wrong. Kind of sad considering the money spent only lasted 4 days
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 9, 2026

recommand products