Pay in installments of $77.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 13 - Aug 18
Promo Codes Available:
For Your Every Summer RSVP, with Code: SUMMER15
Description
RON/CD136 His Tag Protein, HumanProduct Specification Species Human Synonyms RON, CD136, MSP R, MSP receptor, MSPR, MST1R Accession Q04912 Amino Acid Sequence Glu25 Leu571, with C terminal 10*His
Product Specification
| Species | Human |
| Synonyms | RON, CD136, MSP R, MSP receptor, MSPR, MST1R |
| Accession | Q04912 |
| Amino Acid Sequence | Glu25-Leu571, with C-terminal 10*His EDWQCPRTPYAASRDFDVKYVVPSFSAGGLVQAMVTYEGDRNESAVFVAIRNRLHVLGPDLKSVQSLATGPAGDPGCQTCAACGPGPHGPPGDTDTKVLVLDPALPALVSCGSSLQGRCFLHDLEPQGTAVHLAAPACLFSAHHNRPDDCPDCVASPLGTRVTVVEQGQASYFYVASSLDAAVAASFSPRSVSIRRLKADASGFAPGFVALSVLPKHLVSYSIEYVHSFHTGAFVYFLTVQPASVTDDPSALHTRLARLSATEPELGDYRELVLDCRFAPKRRRRGAPEGGQPYPVLRVAHSAPVGAQLATELSIAEGQEVLFGVFVTGKDGGPGVGPNSVVCAFPIDLLDTLIDEGVERCCESPVHPGLRRGLDFFQSPSFCPNPPGLEALSPNTSCRHFPLLVSSSFSRVDLFNGLLGPVQVTALYVTRLDNVTVAHMGTMDGRILQVELVRSLNYLLYVSNFSLGDSGQPVQRDVSRLGDHLLFASGDQVFQVPIQGPGCRHFLTCGRCLRAWHFMGCGWCGNMCGQQKECPGSWQQDHCPPKLGGGSGGGSHHHHHHHHHH |
| Expression System | HEK293 |
| Molecular Weight | 35-43&73-80kDa |
| Purity | >95% by SDS-PAGE |
| Endotoxin | <0.1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | PBS, pH7.4 |
| Reconstitution | Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
| Reference |
1、Mallakin A. et al. (2006) Gene expression profiles of Mst1r-deficient mice during nickel-induced acute lung injury. Am J Respir Cell Mol Biol. 34(1): 15-27. 2、Welm A L. et al. (2007) The macrophage-stimulating protein pathway promotes metastasis in a mouse model for breast cancer and predicts poor prognosis in humans. Proc Natl Acad Sci U S A. 104(18): 7570-5. |
Background
RON is a receptor tyrosine kinase (RTK) of the MET receptor family that is canonically involved in mediating growth and inflammatory signaling. This gene encodes a cell surface receptor for macrophage-stimulating protein (MSP) with tyrosine kinase activity. The mature form of this protein is a heterodimer of disulfide-linked alpha and beta subunits, generated by proteolytic cleavage of a single-chain precursor. It had been shown that MST1R/CD136 plays a critical role in Ni-induced lung injury in mice. The overexpression of MSP, MT-SP1, and MST1R was a strong independent indicator of both metastasis and death in human breast cancer patients and significantly increased the accuracy of an existing gene expression signature for poor prognosis.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.8 ★★★★★
Based on 23 reviews
Sort
Product Reviews
★★★★★ 5
My 90 lb. Pitbull's All-Time Fave Toy
Size: Large, Color: Coral, Size: Large, Color: Coral
I ordered a plethora of new toys for Bruce to keep him occupied while I am working remotely from home. Poor guy gets so bored while I'm stuck in front of my computer 8+ hours a day. All the other toys are animated, but this one is just a big floppy chewy squeaky toy. Bruce quickly lost interest in all the other chirping, hopping, and twirling toys and fell in love with "Diny". When I opened Diny and gave it to Bruce, he had the elated and surprised look of a 3 yr old at Christmas. And he stayed that happy for hours, and then each time he picked up Diny to play. Diny became his go-to toy over all others (and there are many!). It is well made out of durable fabric, and they did not stuff it full of kapoc (I hate kapoc in dogs toys!). And it is delightfully low-tech. Normally he tears a squeaky toy apart as soon as he can isolate the squeaky mechanism. But cleverly, the squeaky box is loose in the long belly so it moves from one end to the other as the toy is handled. That made it difficult for Bruce to locate it. The toy remained in good condition for 2 weeks of near constant attention by Bruce. But yesterday he zeroed in on the squeaky box and ripped Diny to shreds. I was sad to see Diny go so soon. But boy-howdy was Bruce happy with it. I'm gonna buy another because we liked it so much. And so did I : )
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 23, 2024
★★★★★ 5
This is one “under the radar” gem!!
Size: Large, Color: Coral
This is one “under the radar” gem!! Very strong internal squeaker and way tougher than it looks. My big 125lb Shepard-Husky mix gave it heck, then made it his new buddy. He’ll occasionally give it the business but on the whole, it’s surprisingly tough and my big boy loves it. Nice price!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 10, 2026
★★★★★ 4
Cute but small
Size: Large, Color: Skinny Green
Cute stuffy and has not yet ripped. While my dogs plays with it, the toy is a bit small for him. For reference he is 120lbs.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
★★★★★ 5
Perfect for tough chewers!!!
Our dog is an aggressive chewer and this has lasted about two months already!! He loves it! It doesn’t splinter or get sharp edges. Perfect for tough chewers!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
★★★★★ 5
Mini sticks for all the good boys!
My boys LOVE these benebones ! Not to mentioned they are adorable having a mini stick in their mouths. The vet noted my lab needed to start chewing on bones again due to build up & I refused to give them anything other than benebones. They have held up very well & are used daily. The size is plenty big for my 80lb lab and 60lb Australian shepherd. The overall dollar value is great as these are lasting longer than the fish one they normally destroy in a week or two. Overall entertaining for not only my dogs but for my husband and I. Will be buying more in the future.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 18, 2025
recommand products
BrightDeal Replacement Heads for Philips Sonicare DiamondClean – 8 Pack, Compatible with DiamondClean & FlexCare
41.96
Colgate Baking Soda & Peroxide Whitening Toothpaste Frosty Mint Twin Pack - 12 Fl Oz
28.80
Baderke 600 Count Floss Picks Bulk – Dental Flossers for Adults, Family Pack, Travel (Light Blue)
37.98
BURST Charcoal Whitening Toothpaste for Adults (4.7oz) – Sensitive Teeth, Fluoride & Xylitol
31.96
OAP Cleaner - Cleans & Sterilizes Removable Dental & Orthodontic Appliances - Foam
45.98