SKU: 27412412707

Human IL-12 p70, His tag

Sale price$222.75 Regular price$247.50
Save 10%

Pay in installments of $61.88 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human IL-12 p70, His tagProduct Specification Species Human Synonyms Programmed cell death 1, CD279, Programmed death receptor 1 Accession P29459,P29460 Amino Acid Sequence Protein sequence (P29459+P29460, Arg23 Ser219+Ile23 Ser328, with C 10*His)

Product Specification


Species Human
Synonyms Programmed cell death-1, CD279, Programmed death receptor 1
Accession P29459,P29460
Amino Acid Sequence

Protein sequence (P29459+P29460, Arg23-Ser219+Ile23-Ser328, with C-10*His) RNLPVATPDPGMFPCLHHSQNLLRAVSNMLQKARQTLEFYPCTSEEIDHEDITKDKTSTVEACLPLELTKNESCLNSRETSFITNGSCLASRKTSFMMALCLSSIYEDLKMYQVEFKTMNAKLLMDPKRQIFLDQNMLAVIDELMQALNFNSETVPQKSSLEEPDFYKTKIKLCILLHAFRIRAVTIDRVMSYLNAS+IWELKKDVYVVELDWYPDAPGEMVVLTCDTPEEDGITWTLDQSSEVLGSGKTLTIQVKEFGDAGQYTCHKGGEVLSHSLLLLHKKEDGIWSTDILKDQKEPKNKTFLRCEAKNYSGRFTCWWLTTISTDLTFSVKSSRGSSDPQGVTCGAATLSAERVRGDNKEYEYSVECQEDSACPAAEESLPIEVMVDAVHKLKYENYTSSFFIRDIIKPDPPKNLQLKPLKNSRQVEVSWEYPDTWSTPHSYFSLTFCVQVQGKSKREKKDRVFTDKTSATVICRKNASISVRAQDRYYSSSWSEWASVPCSGGGGSHHHHHHHHHH

Expression System HEK293
Molecular Weight

Theoretical: 60kDa Actual: 70kDa

Purity >90% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 ℃ to -70 °C as supplied. 

1 month, 2 to 8 °C under sterile conditions after reconstitution.  

Please avoid repeated freeze-thaw cycles.

Background

Interleukin 12 (IL-12) is an interleukin that is naturally produced by dendritic cells, macrophages, neutrophils, and human B-lymphoblastoid cells (NC-37) in response to antigenic stimulation. IL-12 belongs to the family of interleukin-12. IL-12 family is unique in comprising the only heterodimeric cytokines, which includes IL-12, IL-23, IL-27 and IL-35. Despite sharing many structural features and molecular partners, they mediate surprisingly diverse functional effects. IL-12 is involved in the differentiation of naive T cells into Th1 cells and plays an important role in the activities of natural killer cells and T lymphocytes.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 27412412707

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 9 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
L
Verified Purchase
Lulu McGillicuddy
Pawtucket, US
★★★★★ 4
Easy to use for older folks - and FUN.....???
Size: 100ft, Color: Black
Love the light weight. I can turn the spigot just a bit and the hose will grow in length as i walk around to the front of my house. It's just enough to get a good drenching without knocking my plants around. However, the nylon covering snags easily, and I can see that I may need to replace the hose quicker than I had hoped. I'll probably get the same brand of i have to do so. The sprayer is decent quality, and its multi-functions are handy. I kind of like watching it shrink as I empty it and wrap it up. Never thought a garden hose would actually add a little fun to the chore!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026
C
Verified Purchase
Clutter Hater
Natrona Heights, US
★★★★★ 5
Nice, light hose with nozzle
Size: 25ft, Color: Black
Nice short expandable hose. I had a longer expandable one which got a big leak. So I bought this shorter one since I only use it to water the plants on the patio. So far, it works great; but people have to know that short means short. The nozzle fits this hose; my other nozzle is too big. So having the short hose and the right nozzle in one package works for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 7, 2026
S
Verified Purchase
Susanhapa
Birmingham, US
★★★★★ 5
Love this light weight flexi hose!
Size: 50ft, Color: Black
Great hose. This is my third because the only downside is that the area connected to the spigot can crimp and ultimately leak. It’s easy to keep that from happening if you are the only one using the hose. But if others, like your kids or a garden helper use the hose, they don’t always recognize that.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
T
Verified Purchase
terrorized-by-grumpycat
Los Angeles, US
★★★★★ 4
Weak but excellent please read.
Size: 50ft, Color: Black
Breaks a lot, but Is 100% convenient. My third annual purchase. Beats rubbing stuff off of twisted rubber hoses. Darned if u do. Darned if u don't. A 5-10 yr version one of these will outsell the entire market.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 21, 2026
K
Verified Purchase
Khaleesi
Los Angeles, US
★★★★★ 5
A lot of quality filters for little cost.
Style: 16x20x1, Style: 16x20x1
Been using these for months, great quality. No issues what so ever. I compared price to the 2 main big box stores and this is the best for your bucks. You get a lot more and they are of the same quality. I used to get mine from a big box store with military discount of 10% and this is still a better deal. They fit exactly like the filter I took out, so size is the same. I live FL and run my AC constantly. These last about 2-3 months each. They do no lose their rigidity. They are built with very high quality material. They catch a lot of dust, you can see how dirty they are when replaced. PROS - great quality and last 2-3 months in my AC running constantly - you get a lot for your money when compared to the big box stores - catch a lot of dirt, filters are really dirty after use - very rigid which makes it easy to installation - reinforced wire mesh CONS - None
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 31, 2026

recommand products