SKU: 34674896475

Human SAA-1

$166.50 $185.00
Save 10%
No.2 Bestseller on ateurope.org >

Pay in installments of $46.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 16 - Aug 21

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human SAA-1Product Specification Species Human Synonyms Serum amyloid A 1, SAA1 Accession P0DJI8 Amino Acid Sequence Protein sequence (P0DJI8, Arg19 Tyr122) RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY Expression System E. coli Molecular Weight Predicted MW: 11. 7 kDa Observed MW: 11. 7 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Physical Appearance Lyophilized Powder Storage Buffer Lyophilized from a

Product Specification


Species Human
Synonyms Serum amyloid A-1, SAA1
Accession P0DJI8
Amino Acid Sequence

Protein sequence (P0DJI8, Arg19-Tyr122) RSFFSFLGEAFDGARDMWRAYSDMREANYIGSDKYFHARGNYDAAKRGPGGVWAAEAISDARENIQRFFGHGAEDSLADQAANEWGRSGKDPNHFRPAGLPEKY
Expression System E.coli
Molecular Weight Predicted MW: 11.7 kDa Observed MW: 11.7 kDa
Purity ＞95% by SDS-PAGE
Endotoxin <1EU/μg
Physical Appearance Lyophilized Powder
Storage Buffer Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4.
Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied. 6 months, -20 to -70 °C under sterile conditions after reconstitution. 1 week, 2 to 8 °C under sterile conditions after reconstitution. Please avoid repeated freeze-thaw cycles.

Background

Serum amyloid A1 (SAA1) is a protein that in humans is encoded by the SAA1 gene. SAA1 is a major acute-phase protein mainly produced by hepatocytes in response to infection, tissue injury and malignancy. When released into blood circulation, SAA1 is present as an apolipoprotein associated with high-density lipoprotein (HDL). SAA1 is a major precursor of amyloid A (AA), the deposit of which leads to inflammatory amyloidosis. SAA1 has been a clinical indicator and reliable biomarker for inflammatory diseases, chronic metabolic disorders and late-stage malignancy. SAA1 has been extensively studied for its binding to HDL, with results suggesting a role in lipid metabolism. SAA1 has been associated with tumor pathogenesis, and its gene polymorphism is a contributing factor to certain types of malignant tumors. SAA1 has also been shown to affect the tumor microenvironment and contribute to tumor cell metastasis.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 34674896475

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.9 ★★★★★
Based on 14 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
K
Verified Purchase
Kristina Lee Harris-Osborne
Lake Worth, US
★★★★★ 5
Best toys ever
Color: Blue T-Bone, Size: 2 Count
Some of the best toys ever. Last a long time for my Frenchies.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 15, 2026
T
Verified Purchase
Tracy Vargas
Cuba, US
★★★★★ 4
Great for chewing but very sharp and mangled in a few days
Color: Blue Gator, Size: 1 Count, Color: Blue Gator, Size: 1 Count
I thought this was a fantastic idea having baking soda added for fresh clean teeth while enjoying a new toy. I wanted to review 2 main things about this. First, if my dog enjoyed this toy. That answer would be yes absolutely! She is chewing it as I’m writing this right now. She can spend a good amount of time chewing away on this and it keeps her busy without having to use a rawhide treat which we only try to use if we re going to be gone for longer then 4 hours. The kids love playing fetch with her and she stays engaged the whole time. It is very heavy and when being thrown can become a weapon so I always supervise! Last, the durability of the toy. So it is durable but not completely. As you can see the toy got very sharp where she has been chewing it and I’ve even noticed a little blood on it which means it’s cutting her gums. It wasn’t a large enough amount for me to take it away. It is still almost the exact same size but maybe after a month I will re edit this for more accurate on durability since it’s only been about a week that she has gotten it. Overall, I would recommend this toy it’s a great price and keeps her attention a lot more then other toys I spent twice the amount of money on!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 9, 2022
C
Verified Purchase
CoCo
Grantham, US
★★★★★ 3
Too Hard
Color: Blue T-Bone, Size: 1 Count
I have a pit puppy, 20 lbs, who loves to chew. She's huge for her age, and I wanted to get her a new toy. I bought two different toys, hoping she would like one. The other toy was a hit, they both jumped at it and were excited about it, probably because it had rawhide rings that went with it. This one was immediately thrown to the side, even though my pit loves to chew on non edible toys. I think this one was just too hard, because both her, and my Chihuahua-Jack Russell, weren't interested. It didn't have any smell to attract them, which is why I bought it, because they love peanut butter stuff. I'm not going to go as far as to lick it and taste it... I'm pretty sure it won't taste like peanut butter, either. I feel so bad for my little pittie, she's just sitting here with a sad look on her face because my other dog stole the fun chew toy. I've immediately ordered another of one of those so they both have one, but I've just money wasted on this one. It's probably better they don't like it, I'd be worried about them breaking their teeth. I know it's supposed to be for power chewers, but it has no give whatsoever, just extremely hard, shiny plastic. It's useless, unless you're planning on filing it into a point and making a prison shank. Maybe you can leave it in front of the fridge for your SO to step on in the middle of the night when he goes to steal your almond milk. I'll figure out some way to use it. I did dip it into my boyfriend's peanut butter jar to let my puppy lick it, but I can do that with a spoon. I wanted her to feel like she got something, maybe my other dog will let her have a turn with the fun toy after awhile. That's the only reason I gave it 3 stars. You can dip it in peanut butter and I was being generous.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 27, 2022
R
Verified Purchase
Robert D Fry
Omaha, US
★★★★★ 5
Can become brittle with sharp edges with use.
Color: Blue T-Bone, Size: 1 Count
Our little dog loved chewing this, however after chewing the toy became jagged and brittle with sharp edges that cut into her upper lip which took about 2 weeks to heal. Unfortunately the return window had closed.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 10, 2026
A
Verified Purchase
Amy Bagby
Houston, US
★★★★★ 5
Busy bone
Color: Blue T-Bone, Size: 1 Count, Color: Blue T-Bone, Size: 1 Count
My dog loves these!! Great busy bone! And they can hold it with her paws really well. It does kill your foot if you step on it barefoot in the middle of the night. This is a picture of the bone after 7months.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026

recommand products

Giant Dustwasp [Modern Masters]
400.00
Spark Elemental [Premium Deck Series: Fire and Lightning]
500.00
Accentize DeRoom Pro
129.50
Woodland Stream [Amonkhet]
400.00
Softube Widener
79.00