Pay in installments of $40.00 with
,
and
Shipping Estimate
USA
- USA
- CAN
- USA
- CAN
Ships within 48 hours · Estimated delivery Aug 16 - Aug 21
For Your Every Summer RSVP, with Code: SUMMER15
Description
FABP2 His Tag Protein, HumanProduct Specification Species Human Accession P12104 Amino Acid Sequence Met1 Asp132, with C terminal 8*His MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDHHHHHHHH Expression System E. coli Molecular Weight 16. 5kDa (Reducing) Purity 98% by SDS PAGE & RP HPLC Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Storage Buffer
Product Specification
| Species | Human |
| Accession | P12104 |
| Amino Acid Sequence | Met1-Asp132, with C-terminal 8*His MAFDSTWKVDRSENYDKFMEKMGVNIVKRKLAAHDNLKLTITQEGNKFTVKESSAFRNIEVVFELGVTFNYNLADGTELRGTWSLEGNKLIGKFKRTDNGNELNTVREIIGDELVQTYVYEGVEAKRIFKKDHHHHHHHH |
| Expression System | E.coli |
| Molecular Weight | 16.5kDa (Reducing) |
| Purity | >98% by SDS-PAGE & RP-HPLC |
| Endotoxin | <1EU/μg |
| Conjugation | Unconjugated |
| Tag | His Tag |
| Physical Appearance | Lyophilized Powder |
| Storage Buffer | 20mM Tris, 100mM NaCl, pH8.0 |
| Reconstitution | Reconstitute at 0.1-1mg/ml according to the size in ultrapure water after rapid centrifugation. |
| Stability & Storage | · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃. · 3 months, -20 to -80℃ under sterile conditions after reconstitution. · 1 week, 2 to 8℃ under sterile conditions after reconstitution. · Please avoid repeated freeze-thaw cycles. |
Background
FABP2 is expressed solely in the small intestine, and may control development of the small intestine particularly in response to diet. FABP2 null animals were shown to be resistant to high fat diet induced obesity. FABP2 KO mice fed a high saturated fat low fiber diet showed reduced intestinal villi length and increased transit time, as well as decreased goblet cell density and paneth cell number. Epidemiological studies have long shown that the common Ala54Thr FABP2 polymorphism in humans is associated with metabolic syndrome. The Thr54 FABP was shown to have a slightly higher affinity than the Ala54 containing protein, and human fetal intestinal explants showed that subjects with the Thr54 polymorphism had increased levels of chylomicron secretion . Thus while the complete molecular mechanisms linking these biochemical and cellular observations to the population-based observations remain to be revealed, nutritional intervention strategies may prove helpful in treating metabolic syndrome in Ala54Thr carriers.
Shipping Notes
- Free Standard Shipping on $100+ Orders to the USA.
- Except Preorder products are shipped in 48 hours.
- Delivery to the USA:
- Standard Shipping : 3-10 business days
- If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
- We offer a 30-day return/exchange service after receiving.
- Final sale items are not eligible for returns or exchanges.
- To process your return/exchange, please contact us at [email protected]
- Please click here for more details>>> Return & Exchange Policy
4.6 ★★★★★
Based on 15 reviews
Sort
Product Reviews
★★★★★ 5
Navarro Has Written a J'Accuse for Our Time, a Bare-Knuckled Indictment of an Evil System
Format: Hardcover
Peter Navarro has written an exceptional book that should be required reading for those who seek to understand the abuses of the Biden presidency. The book is a poignant love story, an account of great sacrifice, and an illustration of the true totalitarian nature of the Left. It is a J'Accuse for our time. Like Zola's work, it is a bare-knuckled indictment of an evil system. Unlike Zola, this system conspired not against one man, but against the President and many others--in fact, well more than half the country. Navarro's account is a contemporary reminder of the abuses Arendt and Solzhenitsyn identified regarding not only the banality, capriciousness, and brutal incompetence of tyranny, but that one does not realize when it starts how horrific it will become. If the Left is not stopped, what they did to Navarro will segue to even greater abuses against more and more people. I Went to Prison So You Won't Have To is a warning to all Americans of what is at stake and hence is a book that Americans must read.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 18, 2025
★★★★★ 5
Find Out Who Was the Legal Secretary
Format: Hardcover
I ordered this book after watching Nuremberg with Michael Shannon and Russell Crowe because I wanted to find out who was the woman accompanying Justice Jackson to Germany. Yes, that was not his wife, it was his legal secretary, Elsie Douglas. This book is the only source I could find that goes into any detail about their relationship. What it provides is nowhere near salacious, because it is evident that Jackson took his secrets to the grave. What details it does provide about the evident love triangle that existed in Jackson's life for many years is quite sufficient to explain the events of Nuremberg.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 24, 2026
★★★★★ 4
Well written. Factual sloppiness.
Format: Hardcover
Good insight into Jackson’s approach to the law. Thoroughly researched. Well written. However, Professor White made two egregious factual errors, both of which are an indication of sloppiness on his part, as well as that of his editors and peer reviewers. First, he refers to the World War 2 Chief of Naval Operations as the Secretary of the Navy. Second he states that Los Alamos National Laboratory is in California.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 1, 2026
★★★★★ 4
Judging Jackson
Format: Hardcover
Readers interested in FDR's era, the post-war Nuremberg Trial, and/or such important U.S. Supreme Court events as the Rosenberg spy case and Brown v. Board of Education will enjoy this well-researched book. Illuminating insights as to the characters of his fellow members of the High Court, especially Justices Black and Douglas, are also present.
Of special interest in today's world is Justice Jackson's thinking on the limits of Executive Power in terms of war powers and foreign relations.
I do think non-lawyers will be less interested when the author, a legal scholar, sometime goes into depth exploring aspects of Justice Jackson's thoughts on opaque technical areas, such as diversity jurisdiction under the constitution.
And, I fail to see the need to spend much time on Justice Black's two children, as is done in chapter two "Family Matters." Why do I need to know that his daughter was a mediocre student in college or details about her early love life?
Professor White clearly admires Robert H. Jackson as a fine advocate, brilliant writer, and independent judge, while noting some of his flaws. All in all, a good biography of an important American.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 9, 2025
★★★★★ 5
READ
Format: Hardcover
This is a good book to remind us of the futility of war and the tragedies that occur because of it.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 20, 2026
recommand products
Karácsonyi mintás fenyőfás porcelán kávés csésze aljjal 90 ml díszdobozban Christmas Tree
4090.00
Karácsonyi mintás hóemberes porcelán bögre házikó díszcsomagolásban Snowman
1995.00
breitling chronomat gmt automatic gmt 40 p32398101c1s2
2700.00
Karácsonyi mintás fenyőfás porcelán kávés csésze aljjal 90 ml 2 személyes dobozban Around Christmas Tree
4730.00
Lamborghini Gallardo iPE Cat Pipe '03 - '05
1125.00