SKU: 68090964206

Mouse IFN-alpha1 Protein, His Tag

Sale price$31.50 Regular price$35.00
Save 10%

Pay in installments of $8.75 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Mouse IFN-alpha1 Protein, His TagProduct Specification Species Mouse Synonyms Interferon alpha 1, IFN alpha 1, Ifna1 Accession P01572 Amino Acid Sequence Protein sequence (P01572, Cys24 Lys189, with C His Tag) CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK Expression System HEK293 Molecular Weight Predicted MW: 20. 8 kDa Observed MW: 20 kDa Purity 95% by SDS PAGE

Product Specification


Species Mouse
Synonyms Interferon alpha-1, IFN-alpha-1, Ifna1
Accession P01572
Amino Acid Sequence

Protein sequence (P01572, Cys24-Lys189, with C-His Tag) CDLPQTHNLRNKRALTLLVQMRRLSPLSCLKDRKDFGFPQEKVDAQQIKKAQAIPVLSELTQQILNIFTSKDSSAAWNTTLLDSFCNDLHQQLNDLQGCLMQQVGVQEFPLTQEDALLAVRKYFHRITVYLREKKHSPCAWEVVRAEVWRALSSSANVLGRLREEK

Expression System HEK293
Molecular Weight Predicted MW: 20.8 kDa Observed MW: 20 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

Interferon alpha-1 is a member of the type I interferon family that is produced in response to viral infection as a key part of the innate immune response with potent antiviral, antiproliferative and immunomodulatory properties. This cytokine, like other type I interferons, binds a plasma membrane receptor made of IFNAR1 and IFNAR2 that is ubiquitously expressed, and thus is able to act on virtually all body cells. This cytokine is upregulated in preeclamptic placentas and is thought to be a mediator of preeclampsia.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 68090964206

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.2 ★★★★★
Based on 24 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
A
Verified Purchase
Anthony S
Carnegie, US
★★★★★ 4
Cover too loose.
Size: 300A Fuse Holder
Nice looking, decent quality, versatile for different gauges. My only complaint with this holder is the cover doesn’t stay on very well, bought 3, and all 3 pop off easily, you will need to zip tie on.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on January 12, 2026
K
Verified Purchase
Kurtiss s.
Los Angeles, US
★★★★★ 5
Works as it should.
Size: 300A Fuse Holder
I’ve had several of these in my build for over a year now. Zero issues.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 3, 2025
C
Verified Purchase
Clint
Lowell, US
★★★★★ 5
Good brand
Size: 300A Fuse Holder
Good product
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on November 5, 2025
C
Verified Purchase
chris7soccer
Waukegan, US
★★★★★ 5
Great quality! Sounds great and we’ll built!
I’ve owned a couple of these larger Bluetooth “party” speakers and this is by far the best sounding and well built one I’ve owned. The last one I bought was made by Ion and was much larger, but I think this one sounds WAY better and just looks and feels like quality. The Ion just felt cheap and it died just after the warranty period (of course) It wouldn’t power up anymore even when plugged into a wall outlet. The light show is killer in this if you’re out by the pool at night. I almost forgot to mention, this thing is very lightweight, so easy to carry around. It’s a winner.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 15, 2023
H
Verified Purchase
Hans
Lowell, US
★★★★★ 2
Highs Muddled (XL)
As much as I wanted to love the new Klipsch party speakers, there are better options. I purchased this with the JBL Encore Essential (which you can pick up for fifty bucks less right now), and the JBL won, hands down. Even the heft and finishes of the JBL are superior. Both speakers are approximately equally loud. However, the JBL had boomier and punchier bass, with twice the number of boost options (2 vs 1) as the Klipsch. But the Klipsch really struggled with the highs with its one teeter - the smaller, doubled tweeters of the JBL are immensely cleaner and clearer. Long story short, as much as I wanted this speaker to be awesome, Klipsch leaves a lot to be desired here compared to JBL.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 14, 2023

recommand products