SKU: 75199518192

Rhesus macaque TNFSF15 Protein, His Tag

Sale price$76.50 Regular price$85.00
Save 10%

Pay in installments of $21.25 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 11 - Aug 16

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Rhesus macaque TNFSF15 Protein, His TagProduct Specification Species Rhesus macaque Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand related molecule 1, Vascular endothelial cell growth inhibitor, TNLG1B Accession F6S8F9 Amino Acid Sequence Protein sequence (F6S8F9, Leu72 Leu251, with N His Tag)

Product Specification


Species Rhesus macaque
Synonyms Tumor necrosis factor ligand superfamily member 15, TNF ligand-related molecule 1, Vascular endothelial cell growth inhibitor, TNLG1B
Accession F6S8F9
Amino Acid Sequence

Protein sequence (F6S8F9, Leu72-Leu251, with N-His Tag) LKGQEFAPSHQQVYAPLRADGDKPRAHLTVVRQTPTQHLKNQFPALHWEHELGLAFTKNRMNYTNKFLLIPESGDYFVYSQVTFRGMTSECSEIRQAGRPNKPDSITVVITKVTDSYPEPTQLLMGTKSVCEVGSNWFQPIYLGAMFSLQEGDKLMVNVSDISLVDYTKEDKTFFGAFLL

Expression System HEK293
Molecular Weight Predicted MW: 22.1 kDa Observed MW: 25-30 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 0.2M PBS, pH7.4 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

TNFSF15 (Tumor Necrosis Factor Superfamily Member 15), also known as TL1A, is a cytokine that binds to death receptor 3 (DR3) and decoy receptor 3 (DcR3). It plays a key role in modulating immune responses, particularly in T-cell activation, inflammation, and autoimmune diseases. TNFSF15 is highly expressed in endothelial cells and contributes to angiogenesis and vascular remodeling. Dysregulation of TNFSF15 is linked to inflammatory disorders (e.g., Crohn’s disease, rheumatoid arthritis) and cancers. Its dual role in pro-inflammatory and anti-angiogenic signaling makes it a potential therapeutic target for immune-mediated and vascular diseases.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 75199518192

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 20 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
C
Verified Purchase
Christine Petrowsky
Carnegie, US
★★★★★ 5
Great all around
Color: Blue
We have 4 dogs, lab, pit bull, golden retriever, great dane, I bought 4 sets, they are constantly played and chewed on, and are still around everywhere, great to chew on and play with
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
J
Verified Purchase
Jan Keene
Carnegie, US
★★★★★ 5
Durable chew toy.
Color: Blue
My dog loves these. She chews on them a lot. She seems to like the different shapes. She is part Pit and an aggressive chewer. These chew toys last a long time. And I love the three pack so if we lose one, we always have a spare.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 27, 2026
J
Verified Purchase
Jay
Waukegan, US
★★★★★ 4
Decent durability for the price
Color: Blue
Bought a bunch of these for a dog shelter and have to say - decent for the price of you have aggressive chewers. All of the toys are still going 6+ months later, even with the strongest jawed pitty mix. Does get torn up at the ends but can easily be sanded down for a longer lasting toy, unlike some other hard toys with material not meant for sanding. The antler and ring seem to be favorites. The antler even has a divot so you can put soft treats in it or peanut butter and freeze it for a more interactive experience. Some came with a strong beef/liver smell but not overwhelming or off-putting. They are hefty without being too heavy, less likely to damage floors. Overall a good purchase
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 22, 2026
K
Verified Purchase
Kathryn J Hahn
Massapequa, US
★★★★★ 5
German Shepherd toys
Color: Blue
Great for German shepherds
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 6, 2026
K
Verified Purchase
Kindle Customer
Charlottesville, US
★★★★★ 5
For aggressive chewers
Color: Blue
My pup is an aggressive chewer and these keep him occupied. He keeps coming back for them. Go to replaced old chew toys. Only issue is he leaves his toys everywhere and if you step on them. They are quite sharp
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 26, 2026

recommand products