SKU: 8175398458

IL1RL1/ST2 (isoform A) His Tag Protein, Human

Sale price$207.00 Regular price$230.00
Save 10%

Pay in installments of $57.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

IL1RL1/ST2 (isoform A) His Tag Protein, HumanProduct Specification Species Human Synonyms IL1RL1, DER4, FIT 1, IL33R, ST2, ST2L, ST2V, T1 Accession Q01638 Amino Acid Sequence Lys19 Ser328, with C terminal 8*His

Product Specification


Species Human
Synonyms IL1RL1, DER4, FIT-1, IL33R, ST2, ST2L, ST2V, T1
Accession Q01638
Amino Acid Sequence Lys19-Ser328, with C-terminal 8*His KFSKQSWGLENEALIVRCPRQGKPSYTVDWYYSQTNKSIPTQERNRVFASGQLLKFLPAAVADSGIYTCIVRSPTFNRTGYANVTIYKKQSDCNVPDYLMYSTVSGSEKNSKIYCPTIDLYNWTAPLEWFKNCQALQGSRYRAHKSFLVIDNVMTEDAGDYTCKFIHNENGANYSVTATRSFTVKDEQGFSLFPVIGAPAQNEIKEVEIGKNANLTCSACFGKGTQFLAAVLWQLNGTKITDFGEPRIQQEEGQNQSFSNGLACLDMVLRIADVKEEDLLLQYDCLALNLHGLRRHTVRLSRKNPIDHHSGGGSHHHHHHHH
Expression System HEK293
Molecular Weight 55-72kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1、Savenije O E. et al. (2011) Interleukin-1 receptor-like 1 polymorphisms are associated with serum IL1RL1-a, eosinophils, and asthma in childhood. J Allergy Clin Immunol. 127(3): 750-756.

2、Li H. et al. (2000) The cloning and nucleotide sequence of human ST2L cDNA. Genomics. 67(3): 284-290.

Background

ST2, also known as IL-1 R4 and T1, is an Interleukin-1 receptor family glycoprotein that contributes to Th2 immune responses. Human ST2 consists of a 310 amino acid (aa) extracellular domain (ECD) with three Ig-like domains, a 21 aa transmembrane segment, and a 207 aa cytoplasmic domain with an intracellular TIR domain. ST2 is expressed on the surface of mast cells, activated Th2 cells, macrophages, and cardiac myocytes. It binds IL-33, a cytokine that is upregulated by inflammation or mechanical strain in smooth muscle cells, airway epithelia, keratinocytes, and cardiac fibroblasts. IL-33 binding induces the association of ST2 with IL-1R AcP, a shared signaling subunit that also associates with IL-1 RI and IL-1 R rp2. In macrophages, ST2 interferes with signaling from IL-1 RI and TLR4 by sequestering the adaptor proteins MyD88 and Mal. In addition to its role in promoting mast cell and Th2 dependent inflammation, ST2 activation enhances antigen induced hypernociception and protects from atherosclerosis and cardiac hypertrophy. Upon tissue injury, induces UCP2-dependent mitochondrial rewiring that attenuates the generation of reactive oxygen species and preserves the integrity of Krebs cycle required for persistent production of itaconate and subsequent GATA3-dependent differentiation of inflammation-resolving alternatively activated macrophages.
Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 8175398458

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.7 ★★★★★
Based on 19 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
D
Verified Purchase
Denise Z
Carnegie, US
★★★★★ 5
Good protection for my ipad
Color: Sky Blue
Flap to close is magnetic, so it stays closed. Has a spot for the open for the ipad. Keyboard is a handy feature to have, and love that it lights up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 11, 2026
O
Verified Purchase
Omar Zapata
Louisville, US
★★★★★ 3
Case quality is great, but keyboard is disappointing
Color: Mulberry
The quality of the case is really great. Plum color is beautiful. However, the keyboard is not the best quality. The keys are not sensitive enough and you can easily misspell words if you don’t click a key hard enough. The trackpad shortcuts are cool but inconvenient since you can turn off the shortcuts. You can turn off the trackpad but that just doesn’t work for me.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 16, 2026
T
Verified Purchase
Timothy N.
Port Orchard, US
★★★★★ 5
Economically priced ipad case
Color: Mulberry
There's absolutely no way you could find a better ipad case with a wireless keyboard for this price. My daughter loves it. I was expecting it to feel a little cheap because of the price. I was wrong, this is a great find... thanks
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 7, 2026
B
Verified Purchase
Breana Lopez
West Palm Beach, US
★★★★★ 2
Cute but beware of buttons with a mind of its own.
Color: Pink, Color: Pink
Super cute. Only has 3 keyboard multicolor options and one white light setting. Dimmable. But its functionality needs work. But the keys keep doing weird things like skipping lines, changing excel sheet formatting and just moving where I am typing on it own. Like it will be typing and then move to the beginning of the sentence and keep moving. The feel is super light and the quality of the case is great though. It’s easy to use and install to device with Bluetooth. Value is you get what you paid for. This keyboard is cute but not working quite well. I accidentally ordered a different model for a later iPad and had to return it, but based off of a leader model in comparison to this one, the keyboard just isn’t that great
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 29, 2025
J
Verified Purchase
Jennifer Kuhse
Omaha, US
★★★★★ 5
Cute pink keyboard
Color: Pink
Good product. Serves it purpose and a nice shade of pink. So far no issues with compatibility or usage.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 23, 2026

recommand products