SKU: 97802236512

Monkeypox virus L1R, His Tag

Sale price$153.00 Regular price$170.00
Save 10%

Pay in installments of $42.50 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 13 - Aug 18

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Monkeypox virus L1R, His TagProduct Specification Species MPXV Synonyms Monkeypox,Mpox Accession Q8V4Z7 Amino Acid Sequence MDHNQYLLTMFFADDDSFFKYFASQDDESSLSDILQITQYLDFLLLLLIQSKNKLEAVGHCYESLSEEYRQLTKFTDSQDFKKLFNKVPIVTDGRVKLNKGYLFDFVISLMRFKKESALATTAIDPVRYIDPRRDIAFSNVMDILKSNKVEQGGGGSHHHHHHHHHH Expression System E. coli Molecular Weight 19. 4 kDa Purity 95% by SDS PAGE Endotoxin <1EU g Conjugation Unconjugated Tag His Tag Physical Appearance Lyophilized Powder Reconstitution

Product Specification


Species MPXV
Synonyms Monkeypox,Mpox
Accession Q8V4Z7
Amino Acid Sequence

MDHNQYLLTMFFADDDSFFKYFASQDDESSLSDILQITQYLDFLLLLLIQSKNKLEAVGHCYESLSEEYRQLTKFTDSQDFKKLFNKVPIVTDGRVKLNKGYLFDFVISLMRFKKESALATTAIDPVRYIDPRRDIAFSNVMDILKSNKVEQGGGGSHHHHHHHHHH

Expression System E.coli
Molecular Weight 19.4 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Tag His Tag
Physical Appearance Lyophilized Powder
Reconstitution Reconstitute no more than 0.1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

·12 months from date of receipt, -20 to -70 °C as supplied.

·1 month, 2 to 8 °C under sterile conditions after reconstitution.

·Please avoid repeated freeze-thaw cycles.

Background

L1R is highly homologous to vaccinia virus protein J1R. Vaccinia virus contains a conserved J1R open reading frame that encodes a late protein of 17.8 kDa. The 18-kDa J1R protein is associated mainly with the membrane fraction of intracellular mature virus particles.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 97802236512

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.1 ★★★★★
Based on 30 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
B
Verified Purchase
B. Hamlin
Port Orchard, US
★★★★★ 4
Better than expected...
Style: For Him
I love going to a craft show or a place that sells a handcrafted soap. A good craftsperson can produce a high-quality soap that cleanses, moisturizes, and leaves a good scent. I gave these a shot after running out of those soaps. They did beat my expectations. I thought these would be a factory produced and chemically. While you can tell these are churned out pretty regularly in some sort of factory, the overall quality is good. Each scent is full and unique without being overpowering. They seem to be natural and not generic chemical smells. Really enjoy each of the unique scents. The bars themselves aren't that big. They come in a piece of cardboard and are very uniform. There is some texture to the soap, as well as an added bit of something to give it some grit. I like it. This isn't lava soap but there is something (about the size of fresh ground pepped) mixed throughout each bar. A drawback overall is how long they last. I would estimate less than a week for a daily user. I thought, given the denseness, they would last for a longer than they do. I'll probably use the entire box in under a month. Of note is the lack of slimy or slipperiness to the soap. I like this. Some soaps that I've used in the past leave you slimy and you can barely hang on to the bar. This rinses very well and doesn't make you feel slimy. Overall, these are a good replacement for the 'true' homemade soap. I am happy with them and would purchase them again.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 30, 2020
E
Verified Purchase
Eric Gibbons
Belleville, US
★★★★★ 5
Game changer!!!!
Style: For Him
Like a lot of folk who watch youtube I have been bombarded by Dr. Squatch soap ads over the last couple yrs. Couple that with my new mission of doing things as close to natural as I can, and my interest was peaked. I then did what most folks do when they want to learn more about said product, I went to the site and dropped a proverbial brick in my shorts when I looked at the price!!! I didn't want to give up on swapping the basement lab experiment that is my normal body wash for something more natural, but I also didn't want to sell one (or both) of my kids to do it. Enter crate 61. I didn't know this company from adam, they just had a "manly" variety box at a decent price with simple ingredients so why not. I'm here to tell you I'm never going back to "normal" body wash again. I have the definition of combination skin. My father's skin was greasy, my moms skin is bone dry. Therefore for the first hour after my shower I have tumble weeds rolling across my forehead, and from then on, It feels like I headbutted an oil tanker. After a couple days of using this soap I felt 1000% more balanced. It's not a miracle in a bar, but I have never felt moisturized AND clean getting out of the shower in my whole life. Those effects last hours. Eventually I get greasy again but you can't fight nature regardless (this also does't claim too) but the point is I feel great. The main ingredients in all of the bars are a combination of olive oil, coconut oil, avocado and palm oil with other variations depending on the bar. Those good oils have been proven to have an anti inflammatory effect on the skin and while I wouldn't call it a cure for acne, my skin is much clearer. I chalk it up to simple ingredients vs chemicals in modern soaps. As far as the scents, It's a mixed bag and completely subjective. Beside I have never had a shower wash of any kind stick around for more than an hr anyway so It's a moot point. I for one dig some, not others, hence the variety pack but I'll know what to order going forward. The 6 bars do come in a very nice box and while it would be a fine gift as packaged, it tends to combine the smells until they are removed for a day or so. In regards to longevity, 1 bar has so far lasted 2 weeks with only half gone. I'm an average dude but I'm bald (i use it for hair soap too with no dandruff) and basically take military showers so millage may vary. I recommend using a loofa and turn the heat down on your shower just a little. If you use the bar directly on your skin in a hot shower it's probably going to disappear quick. Honestly I'm ecstatic over this product and even recommended it to my sister who has the same dry vs greasy daily epic battle type skin as I do. The only downside so far is the eucamint bar I'm using now is not my fav and I want to move on but its holding up like a champ, go figure! UPDATE: 4/12/20 I'm still not through the entire box of soap and it still feels great to shower with. I have 2 full bars left after all this time so longevity is a plus. I have noticed that using a loofa less is more. I actually get a better scent out of the soap if I don't go crazy with it, just a few quick rubs on the loofa and I'm golden plus I bought a soap saver and keep it on the opposite end of the shower head. In all fairness I shower about 2 to 3 times a week with Neutrogena acne soap because of the aforementioned greasy skin but this soap helps keep that soap from drying everything out too much.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on July 26, 2020
C
Verified Purchase
C. Dickerson
Phoenix, US
★★★★★ 5
Easy recommendation
Style: For Him
Actual reviewer, not paid to make this, nor was incentivized. Great value - these soaps last around 3 months each. Scents are non-offensive, soap doesn't leave my skin dry, and I feel clean afterward. They also lather up really well!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on May 4, 2026
T
Verified Purchase
This little roller is great works better than higher priced machines and you get the cleaning kit with it . recommend this to anyone just starting to roll their own . quality and affordability I like it
Whiting, US
★★★★★ 5
Great soap
Style: For Him
Luv this soap better than the Dr. Squash soap so far . It lathers good cleans ,no film , and luv the smell of it . I will most definitely buy again . It's my soap from now on for sure . Luv everything about it
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on June 3, 2026
M
Verified Purchase
Matt C.
San Leandro, US
★★★★★ 3
IMMEDIATE REACTION, PLUS FOLLOW UP AFTER A WEEK!
Style: For Him
**Package arrived LITERALLY 5 minutes ago, here is my immediate initial reaction, and then I'll actually post this after USING the soap and getting a better feel for the product.** Keeping in mind that smell is subjective, here are my knee jerk thoughts on the bars of soap: - Firstly, I can smell the soap through the bag (and box). Whatever scent this is, it's POTENT. - Opening the box, the bars of soap look a LITTLE small. Not egregiously so, but a little bit smaller than your average bar of soap; BUT I check them against a new bar of Dove soap that I have, and they are identical. The eyes are playing tricks on you with these. - Here is the breakdown of the 6 scents - Activated Charcoal. This is what I was HOPING would smell like the "Pine Tar" that other companies (like Dr. Squatch, which I've never used, btw) have, but it is the "soap-est" smelling soap, with a hint of tar. It smells a little bit like a can of new paint. - Tango Mango. IMHO, the best smelling of the 6, with strong citrus smells. Very lemon-y, but pleasant. - Eucamint. Ahhh, here's what was permiating out of the box. This smell is STRONG, with an AGGRESSIVE mint smell. Like, Ben Gay mint. And as strong to boot. It doesn't smell BAD, but it's hands down the strongest scent. - Oatmeal Shea. Meh. Kinda smells like an old coat that would be hanging in your grandfathers closet. It's not a BAD smell, but it has this weird odor to it, like when you leave a can of peanuts in your cupboard for a long time, and then go back and smell it. - Patchouli Lime. This one kind of smells like a mixture of Activated Charcoal, Eucamint and Oatmeal Shea. It smells like a room that you just painted a day or two ago, and it definitely has the Ben Gay after aroma lingering. - Apline Spice. This smells like a box. Like find an empty cardboard box, open it, and take a whiff. Boom, Alpine Spice. My least favorite. I will say, none of them STINK; as in there isn't a smell that I'm like, "ewww, I don't want to smell like AT ALL!" Which sounds weird, because I described some of them as "paint," "an old coat," and "a cardboard box," but I feel that those are just very passive smells, not aggressively bad ones. If there is a problem soap, I would assume it's going to be Eucamint, because it might just be too overpowering, although I've found that the more you smell them, they seem to mellow out. I imagine that after a shower with these, the smell will dissipate enough that it will be more mild. Still, with the exception of Tango Mango; a very good smelling soap mind you, I'd say they are all very "manly" scents, and I'm excited to try them out. Ok, so I'm a little over a week in, and here's my final take. (I made it through Activated Charcoal and Tango Mango): First, the scents ABSOLUTELY mellow out when used to actually shower with them. My wife, who admittedly isn't really up on me like that, hasn't even mentioned me smelling differently than the last 11 years. So, if she's even noticed, it's not on a level to make a fuss about. This is important because fresh from the box, these things have some powerful scents, but they are definitely tamed by washing with them. The bars last ABOUT 7 showers. Obviously, your mileage will vary based on how long you're in the shower, how much you scrub, how you store them, etc, but I was able to get 7 GOOD showers out of these. I have them in these natural sisal (whatever that is) exfoliating bags that help lather and store the soap, and really did some good scrubbing in my showers. The bars lather decently, but I'm not sure how much the bag helps with that. If you are a once a day showerer, a bar a week is a very fair approximation of what you'll get. I definitely felt.....SOMETHING I didn't before with my shower gel showers. I don't know if that's the moisturizing, or the exfoliation, but my skin felt a little different after showering. A decent buy. I'm not thrilled, but I'm not upset either. I don't think it changed my life, or even the way I shower, but I'm not mad at the experiment. I may try the Dr. Squatch soaps to see how all these stack up.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 1, 2020

recommand products