SKU: 10138447503

LTBR/TNFRSF3 Fc Chimera Protein, Human

Sale price$212.40 Regular price$236.00
Save 10%

Pay in installments of $59.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 17 - Aug 22

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

LTBR/TNFRSF3 Fc Chimera Protein, HumanProduct Specification Species Human Antigen LTBR TNFRSF3 Synonyms Lymphotoxin beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2 related protein Accession P36941 Amino Acid Sequence Gln31 Met227, with C terminal Human IgG Fc

Product Specification


Species Human
Antigen LTBR/TNFRSF3
Synonyms Lymphotoxin-beta receptor, Tumor necrosis factor C receptor, Tumor necrosis factor receptor 2-related protein
Accession P36941
Amino Acid Sequence

Gln31-Met227, with C-terminal Human IgG Fc QAVPPYASENQTCRDQEKEYYEPQHRICCSRCPPGTYVSAKCSRIRDTVCATCAENSYNEHWNYLTICQLCRPCDPVMGLEEIAPCTSKRKTQCRCQPGMFCAAWALECTHCELLSDCPPGTEAELKDEVGKGNNHCVPCKAGHFQNTSSPSARCQPHTRCENQGLVEAAPGTAQSDTTCKNPLEPLPPEMSGTMLMIEGRMDPKSSDKTHTCPPCPAPELLGGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVKFNWYVDGVEVHNAKTKPREEQYNSTYRVVSVLTVLHQDWLNGKEYKCKVSNKALPAPIEKTISKAKGQPREPQVYTLPPSRDELTKNQVSLTCLVKGFYPSDIAVEWESNGQPENNYKTTPPVLDSDGSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK

Expression System HEK293
Molecular Weight 55-65kDa
Purity >95% by SDS-PAGE
Endotoxin <0.1EU/μg
Conjugation Unconjugated
Tag Human Fc Tag
Physical Appearance Lyophilized Powder
Storage Buffer PBS, pH7.4
Reconstitution Reconstitute at 0.1-1 mg/ml according to the size in ultrapure water after rapid centrifugation.
Stability & Storage · 12 months from date of receipt, lyophilized powder stored at -20 to -80℃.
· 3 months, -20 to -80℃ under sterile conditions after reconstitution.
· 1 week, 2 to 8℃ under sterile conditions after reconstitution.
· Please avoid repeated freeze-thaw cycles.
Reference

1. Piao W., Xiong Y., Li L., et al. Regulatory T cells condition lymphatic endothelia for enhanced transendothelial migration. Cell Reports. 2020;30(4):1052-1062.e5.
2. Schneider K, Potter KG, and Ware CF (2004). Lymphotoxin and LIGHT signaling pathways and target genes. Immunol. Rev. 202, 49-66.
3. Norris P.S., Ware C.F. Madame Curie Bioscience Database. Landes Bioscience; Austin, TX, USA: 2000-2013.
4. Force W.R., Walter B.N., Hession C., Tizard R., Kozak C.A., Browning J.L., Ware C.F. Mouse lymphotoxin-beta receptor. Molecular genetics, ligand binding, and expression. J. Immunol. 1995; 155:5280-5288.
5. Boehm T., Scheu S., Pfeffer K., Bleul C.C. Thymic medullary epithelial cell differentiation, thymocyte emigration, and the control of autoimmunity require lympho-epithelial cross talk via LTbetaR. J. Exp. Med. 2003; 198:757-769.

Background

LTBR is a type 1 single transmembrane protein and member of the tumor necrosis factor receptor (TNFR) family that plays a critical role in the development of secondary lymphoid organs. The human LTBR gene is located on chromosome 12p13, in the same locus as two other members of the TNFR family—TNFR1 and CD27. The human LTBR gene shares 76% homology at the nucleic acid level with its mouse counterpart, located on chromosome 6. LTBR is widely expressed in blood and LECs, intestinal epithelial cells, dendritic cells (DCs), and lymph node (LN) stromal cells. The protein is conspicuously absent in T cells, B cells, and NK cells. LTBR binds strongly to two different natural ligands in homeostatic conditions, LTα1β2 and LIGHT (TNFSF14). LTBR signaling pathway plays an essential role in lymphatic organogenesis, tissue regeneration, organ development, tumorigenesis, and immune response to pathogen infection. Functionally, the absence of LTBR signaling leads to the retention of mature T cells in the thymic medulla.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 10138447503

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.4 ★★★★★
Based on 12 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
R
Verified Purchase
Rosalie
Whiting, US
★★★★★ 5
Best dog ball
This is our go to dog toy for our German shepherd. its great for training in sports as well as outings at the beach, considering it floats! Never had him destroy one, so its extremely durable. I like that its a bright color so its easier to locate when i accidently let go of the rope too late and end up whipping it 20 ft into the woods. Easy to clean, all around just a great toy. Also love the large size as having a dog accidently lodge a ball into its throat is a real fear of mine, I do not have to worry about that with this toy. I should also mention the rope is a must, as touching a slobbery ball isn't the greatest feeling in the world and it puts your hands out of harms way. I will forever order these.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 7, 2025
M
Verified Purchase
Mavis Adam
Los Angeles, US
★★★★★ 4
Great ball, bad rope
Size: Medium, Number of Items: 1, Size: Medium, Number of Items: 1
My dog and I love the starmark ball on a rope tug toys. While this is one of the best tug toys we have found, I am continually disappointed with the quality of the rope. The plastic sleeve comes off the first day, and after that the stitching begins to weaken until the rope ends come apart and the rope slides out of the ball. Is there a way to improve this design so that this toy lasts longer? My dog is not left alone with the toy, it is only used as an interactive tug toy as a training reward. I am updating my review now several months later. I reinforced the rope with a paracord braid and the toy now lasts a very long time. My dog and I play with this toy everyday on our morning hike. He is a large German Shepherd with high ball drive. He carries this ball in his mouth several miles on our morning hike. We play fetch in the fields near our home and in the lake beyond the fields with this toy every day. This toy is his reward in obedience training and we play a lot of tug with it every day. Reinforcing the handle has made a huge difference as the toy lasts and lasts now with the improved rope. Great ball, we will always have a collection of them at our house!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 19, 2020
A
Verified Purchase
AGJ
Lexington, US
★★★★★ 5
Great for training and play!
Size: Medium, Number of Items: 1
My German shepherd love this toy! Great to take on walks with you as light weight and can fit in your pocket. Stands up to the toughest of play. Great as reward toy for training in place of treats! We always have one on hand at home or out and about!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on March 18, 2026
R
Verified Purchase
Room112
Waukegan, US
★★★★★ 5
Great for big dogs
Size: Medium, Number of Items: 1
Our pup is now 15 months old (nearly 110 lb and still growing). We got this ball when he was 3 or 4 months old. GOODS - - Our pup fetches with extreme drive, and the rope helps him quickly snatch the ball off the ground (versus a tennis ball, in which we are worried he will go head over heels at times) - Our pup also loves to play fetch in the water, and this ball floats great and again, the rope gives another point to bite onto - The yellow color is easy to see, even in grass - Our pup typically fetches the ball, and leaves the rope mostly out of his mouth. So, throwing the ball doesn't result in saliva-covered hands - It's pretty easy to throw the ball 50', and possible to throw it 100' - It doesn't roll/bounce, so if you are for example playing fetch on your front lawn and are concerned with a tennis ball rolling into the street, this one alleviates that issue - Our pup is spoiled and has several balls. This is absolutely his go to ball. We have woken up in the morning before to see him standing next to the bed with the ball in his mouth, asking us to get up and play. BADS - - Occasionally when he goes to fetch it, he will step on the rope as he tries to pull up on the ball. - We have gotten this ball stuck in trees multiple times. In fact, there is one stuck on the roof of our church from playing fetch on the lawn there. :-/ Not a fault of the ball, but if you start whipping it around like nunchucks, it might not go where you want. - The near max you can through this ball is 100'. And since it doesn't roll/bounce, throw distance is throttled. We often play fetch in a local baseball field, and have no issue wearing him out with this ball. However, if you are planning on throwing a ball the distance of half a football field, you might want to consider something else. SIZE - - We purchased both the medium and the large. Even though our pup is huge and can fit a soccer ball in his mouth, he still prefers the medium. It's easier for him to get in his mouth and breath while running back. The medium is the size of an orange, whereas the large is the size of a grapefruit. DURABILITY - - We have gone through about 4 of these balls, BUT this is because we lost 3 of them. We believe he dropped one out of the car window while we were driving, one is on the roof of our church, and I forget about the other one. On the first one we had, the stitching behind the black tape was down to a few threads after about 5 months. Given duration we use these balls (every day) and the joy he gets from them, I feel the durability is good for the price. - We do play tug with the ball at times, and no issues there Enjoy!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on December 17, 2013
G
Verified Purchase
Greg
Phoenix, US
★★★★★ 3
Good but better options out there.
Good ball, but is a cheaper version of the Foamster sold online. The rope is cheap and comes apart, and can be abrasive to a dogs mouth. The Foamster uses a higher quality ball and are more durable and use grippy biothane straps rather than cheap rope. They are also made to order in the USA with lots of fun colors. Worth the extra money if your dog likes these balls.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 10, 2025

recommand products