SKU: 16093208175

Human ApoE2 Protein, His Tag

Sale price$108.00 Regular price$120.00
Save 10%

Pay in installments of $30.00 with ShopPay, AfterPay and Klarna

Shipping Estimate
USA
  • USA
  • CAN

Ships within 48 hours · Estimated delivery Aug 12 - Aug 17

Promo Codes Available:

For Your Every Summer RSVP, with Code: SUMMER15

Description

Human ApoE2 Protein, His TagProduct Specification Species Human Synonyms Apolipoprotein E, Apo E, APOE Accession P02649 Amino Acid Sequence Protein sequence (P02649, Lys19 His317(Arg176Cys), with C His Tag)

Product Specification


Species Human
Synonyms Apolipoprotein E, Apo-E, APOE
Accession P02649
Amino Acid Sequence

Protein sequence (P02649, Lys19-His317(Arg176Cys), with C-His Tag) KVEQAVETEPEPELRQQTEWQSGQRWELALGRFWDYLRWVQTLSEQVQEELLSSQVTQELRALMDETMKELKAYKSELEEQLTPVAEETRARLSKELQAAQARLGADMEDVCGRLVQYRGEVQAMLGQSTEELRVRLASHLRKLRKRLLRDADDLQKCLAVYQAGAREGAERGLSAIRERLGPLVEQGRVRAATVGSLAGQPLQERAQAWGERLRARMEEMGSRTRDRLDEVKEQVAEVRAKLEEQAQQIRLQAEAFQARLKSWFEPLVEDMQRQWAGLVEKVQAAVGTSAAPVPSDNH

Expression System HEK293
Molecular Weight Predicted MW: 35.9 kDa Observed MW: 35-40 kDa
Purity >95% by SDS-PAGE
Endotoxin <1EU/μg
Conjugation Unconjugated
Physical Appearance Lyophilized powder
Storage Buffer

Lyophilized from a 0.2 μm filtered solution of 20mM Tris-HCl, pH8.0 with 3% trehalose.

Reconstitution Reconstitute no more than 1 mg/mL according to the size in deionized water after rapid centrifugation.
Stability & Storage

12 months from date of receipt, -20 to -70 °C as supplied.
6 months, -20 to -70 °C under sterile conditions after reconstitution.
1 week, 2 to 8 °C under sterile conditions after reconstitution.
Please avoid repeated freeze-thaw cycles.

Background

The APOE2 protein is one of three major isoforms (E2, E3, E4) of apolipoprotein E (APOE), a key lipid transport protein involved in cholesterol metabolism and neuronal repair. Encoded by the APOE gene, APOE2 differs from the most common isoform (APOE3) by a cysteine-for-arginine substitution at position 158 (Cys158Arg), altering its structure and receptor-binding affinity. While APOE2 is associated with a reduced risk of late-onset Alzheimer’s disease (AD) compared to APOE4, homozygous carriers may develop type III hyperlipoproteinemia, a lipid disorder. APOE2 exhibits weaker binding to LDL receptors, impairing clearance of triglyceride-rich lipoproteins. Its neuroprotective effects in AD may stem from enhanced amyloid-β clearance and anti-inflammatory properties.

Shipping Notes
  • Free Standard Shipping on $100+ Orders to the USA.
  • Except Preorder products are shipped in 48 hours.
  • Delivery to the USA:
  1. Standard Shipping : 3-10 business days
  • If time is of the essence, please consider selecting expedited delivery for faster service.
Exchange/Return Notes
  • We offer a 30-day return/exchange service after receiving.
  • Final sale items are not eligible for returns or exchanges.
  • To process your return/exchange, please contact us at [email protected]
  • Please click here for more details>>> Return & Exchange Policy
SKU: 16093208175

Discover Niche Categories That Outsell

Top-Converting Item to Boost Your Average Order

4.3 ★★★★★
Based on 27 reviews
Sort
Highest Rating
Newest First
Oldest First
Product Reviews
T
Verified Purchase
trinityknt7
Fort Morgan, US
★★★★★ 4
Hot twists
Format: Kindle
This will keep you on your toes toes in a hot twisty mess. You want to love, hate and root for whom is the big question. I’m quickly getting the next book because it ends on a cliffhanger and damn, it’s got me ready to tear into it!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on February 16, 2026
L
Verified Purchase
LanaB
Whiting, US
★★★★★ 5
Ends in a cliffhanger
Format: Kindle
Thankfully, the next book is already available. Roxy Collins is the queen of omegaverse slow burn. This particular series is omegaverse with wolf shifters. Thoroughly enjoyed this book! Lots of suspense and trying to figure out what is true and what's really going on. I loved it! Pretty spicy once the action starts. Heats are pretty much always spicy. There is a little bit of male interaction, but not full-on shmex. Definitely recommend.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on April 29, 2025
D
Verified Purchase
Dolores Evans
New York, US
★★★★★ 5
Epic!!!!
Format: Kindle
Absolutely addicted from the first page. The twists and turns, world building and character development all come together for the perfect Omegaverse. And let's not forget that spice because knots are life and these are spectacular. Running for book #2 because that cliffhanger was torturous.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on August 17, 2024
R
Verified Purchase
Ruth Ann Burt
Alexandria, US
★★★★★ 5
Great book
Format: Kindle
I absolutely feel in love with all 4 characters!!! The bedroom scenes were 🌋🌡🔥🔥🔥. I couldn't put this book down!!! I'm hooked for the whole series Book 2 here I come!!!!! Its a fun easy book and story to read!!
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on October 4, 2024
D
Verified Purchase
Danyelle
Fort Morgan, US
★★★★★ 4
Fun with a late blooming omega
Format: Kindle
I like this book. The story is fun, cute, and sexy. There's just a little drama, some excellent, steamy scenes, and a fairly good relationship building storyline. I especially like how all the main characters are a bit older than the usual 20 somethings I tend to see in this kind of book. Having said that, I wish there were more descriptions of the places, as well as the food in the fancy restaurant. I enjoyed the cocktails at the club, so I missed that kind of detail when Gray took Madison on a dinner date. I also wish there had been more interaction between Lucas and Madison, and Lucas and Rian. It felt a bit lopsided, with a focus on Rian, Madison, and Gray. I wish it had been proofread - there are a lot of typos, but nothing too distracting.
WAS THIS REVIEW HELPFUL?YesReportShare
Reviewed in the United States on September 12, 2022

recommand products